SAXSdb — 7bvh

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Integral membrane indolylacetylinositol arabinosyltransferase EmbC

Mycolicibacterium smegmatis MC2 155

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 4 其他Polymer 8	Meromycolate extension acyl carrier protein × 2 （A0R0B3） alpha-D-arabinofuranose-(1-5)-alpha-D-arabinofuranose × 2 alpha-D-glucopyranose-(1-4)-beta-D-glucopyranose × 6 CALCIUM ION × 2 PHOSPHATE ION × 2 alpha-D-arabinofuranose × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I7FMU5_MYCS2
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 14–1087； UniProt 1–1074 Author chain B； PDBConstruct 14–1087； UniProt 1–1074

Meromycolate extension acyl carrier protein

OrganismNot specified

UniProt A0R0B3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 4 其他Polymer 8	Integral membrane indolylacetylinositol arabinosyltransferase EmbC × 2 （I7FMU5） alpha-D-arabinofuranose-(1-5)-alpha-D-arabinofuranose × 2 alpha-D-glucopyranose-(1-4)-beta-D-glucopyranose × 6 CALCIUM ION × 2 PHOSPHATE ION × 2 alpha-D-arabinofuranose × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACPM_MYCS2
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–99； UniProt 1–99 Author chain D； PDBConstruct 1–99； UniProt 1–99

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7bvh
Deposition date deposition_date	2020-04-10
Structure title title	Crystal structure of arabinosyltransferase EmbC2-AcpM2 complex from Mycobacterium smegmatis complexed with di-arabinose
Keywords keywords	cell wall synthesis, arabinosyltransferase, drug target, TRANSFERASE; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7bvh__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7bvh__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7bvh__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	43.42 Å
Rg (electron density)	42.45 Å
Total Rg	42.89 Å
Atom count	17316
Residues	2238
Excluded volume	310250 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7bvh__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Integral membrane indolylacetylinositol arabinosyltransferase EmbC
Molecular weight formula_weight	119999.4 kDa
EC 编号 ec_number	2.4.2.34
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	17316

MPEVVGSYFQSNAMTGPHAAGGSNHRTARLVAIIAGLLGTLMAIATPLLPVEQTTAELNWPQNGVWQSVDAPLIGYVATDLTVTVPCQAAAGLVGPENRNRSVLLSTVPKQAPKAIDRGLLIERINNDLTVIVRNTPVVSAPLEQVLSPDCRYLTFTAHADKVTGEFVGLTQGPDDDDPGEAVRGERSGYDFRPQIVGVFTDLSGPAPEGLQLSATIDTRYSTSPTLLKLLAMIVGVAMTVIALGALHVLDCADGRRHKRFLPSRWWSMTPLDGLVSAMLVWWHFVGANTADDGYILTMARVSEHAGYMANYYRWFGTPESPFGWYYDLLALWAHVSTASVWMRFPTLLMGLACWWVISREVIPRLGAAAKHSRAAAWTAAGLFLAFWLPLNNGLRPEPIIALGILLTWCSVERGVATSRLLPVAVAIIIGALTLFSGPTGIAAVGALLVAIGPLKTIVAAHVSRFGYWALLAPIAAAGTVTIFLIFRDQTLAAELQASSFKSAVGPSLAWFDEHIRYSRLFTTSPDGSVARRFAVLTLLLALAVSIAMTLRKGRIPGTALGPSRRIIGITIISFLAMMFTPTKWTHHFGVFAGLAGCLGALAAVAVTTTAMKSRRNRTVFGAAVLFVTALSFATVNGWWYVSNFGVPWSNSFPEFKFGFTTMLLGLSVLALLVAAWFHFSGRDVSPDRPQRRWQRLLVAPLAVATWALVIFEVVSLTLGMINQYPAWSVGRSNLNALTGKTCGLANDVLVEQNANAGMLTPIGEPAGQALGAVTSLGFGPNGIPSDVSADPVMEQPGTDNFADSDSGVVTGTEVGTEGGTTAAAGINGSRARLPYGLNPATTPVLGSWRSGTQQPAVLRSAWYRLPDRDQAGPLLVVSAAGRFDQGEVEVQWATDEQAAANEPGGSITFGDVGAAPAWRNLRAPLSSIPPEATQIRLVASDDDLAPQHWIALTPPRIPELRTLQEVVGSSDPVMLDWLVGLAFPCQRPFDHRYGVVEVPKWRILPDRFGAEANSPVMDYLGGGPLGITELLLRPSSVPTYLKDDWYRDWGSLQRLTPWYPDAQPARLDLGTATRSGWWSPAPLRLSHLGGIKAFLEVLFQGPHHHHHHHHHH

Source Source

Source organism organism	Mycolicibacterium smegmatis MC2 155
NCBI taxonomy ID ncbi_taxonomy_id	246196
Host organism host_organism	Mycolicibacterium smegmatis MC2 155

Entity 2 Entity 2 polymer

Description description	Meromycolate extension acyl carrier protein
Molecular weight formula_weight	10743.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

MAATQEEIIAGLAEIIEEVTGIEPSEVTPEKSFVDDLDIDSLSMVEIAVQTEDKYGVKIPDEDLAGLRTVGDVVAYIQKLEEENPEAAAALREKFAADQ

Entity 3 Entity 3 branched

Description description	alpha-D-arabinofuranose-(1-5)-alpha-D-arabinofuranose
Molecular weight formula_weight	282.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 branched

Description description	alpha-D-glucopyranose-(1-4)-beta-D-glucopyranose
Molecular weight formula_weight	342.3 kDa
Source method src_method	man
Copy count entity_count	6

Entity 5 Entity 5 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 6 Entity 6 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 7 Entity 7 non-polymer

Description description	alpha-D-arabinofuranose
Molecular weight formula_weight	150.1 kDa
Source method src_method	syn
Copy count entity_count	4

▼

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	7bvhA01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	610 — arabinofuranosyltransferase like domain

▶

Unit-cell length a length_a	121.080 Å
Unit-cell length b length_b	176.330 Å
Unit-cell length c length_c	207.770 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	3.300 Å
Low-resolution limit resolution_low	49.670 Å
R factor r_factor	0.2340
R_work r_work	0.2320
R_free r_free	0.2650

Crystal structure of arabinosyltransferase EmbC2-AcpM2 complex from Mycobacterium smegmatis complexed with di-arabinose

1. Protein Identity and Related Structures Protein Identity & Related Structures

Integral membrane indolylacetylinositol arabinosyltransferase EmbC

State in the Current Structure

Other States of the Same Protein in the Database

Meromycolate extension acyl carrier protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7bvh__assembly_1__model_1

7bvh__assembly_1__model_1 | I(q)

7bvh__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 branched

Entity 4 Entity 4 branched

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

7. Citations (1)

Crystal structure of arabinosyltransferase EmbC2-AcpM2 complex from Mycobacterium smegmatis complexed with di-arabinose

1. Protein Identity and Related Structures Protein Identity & Related Structures

Integral membrane indolylacetylinositol arabinosyltransferase EmbC

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Meromycolate extension acyl carrier protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7bvh__assembly_1__model_1

7bvh__assembly_1__model_1 | I(q)

7bvh__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 branched

Entity 4 Entity 4 branched

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

7. Citations (1)