SAXSdb — 7dym

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tox-REase-5 domain-containing protein

Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Imm52 domain-containing protein × 1 （Q9HXA5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9HXA6_PSEAE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–241； UniProt 1–261

Imm52 domain-containing protein

Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

UniProt Q9HXA5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Tox-REase-5 domain-containing protein × 1 （Q9HXA6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9HXA5_PSEAE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–239； UniProt 1–239

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7dym
Deposition date deposition_date	2021-01-22
Structure title title	Pseudomonas aeruginosa TseT-TsiT complex
Keywords keywords	T6SS, immunity, effector, nuclease, TOXIN; TOXIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7dym__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7dym__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7dym__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	24.00 Å
Rg (electron density)	22.78 Å
Total Rg	23.71 Å
Atom count	3342
Residues	409
Excluded volume	59090 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7dym__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Tox-REase-5 domain-containing protein
Molecular weight formula_weight	27708.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	3342

MSGIGALFRPLPRMGPRLPFELPAPPRPHLPMPAPRPLPRPAPGALTLSRDRTREAERDCSKSQGRDKDCVECPPSRGEMAIANNGKGHSMSDLSARYQQWVTNFPFPHEWFWSGTWWDGFDEPRCTLLEAKANYAFLFVPLLGVPRPWARAKVKSDLLQKAEVHSDKARPTPPVFVEWHFLQRIVYEYCAAEYLRMGLANLKAFWNPMPGTDEHDDYQETRAKEQEEMKRFCEENPGYCA

Source Source

Source organism organism	Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
NCBI taxonomy ID ncbi_taxonomy_id	208964
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Imm52 domain-containing protein
Molecular weight formula_weight	27329.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MTDAKAFRRYIFELYFDPARLLELDDDQHLQRIERFLDALAPLHPVLENWYLCGDSLRDALSHNVTEHRQDLAKALSRDRRTRAVELVLWNGEEDPLKGGLSLDYEASGRAVSSRLQLEDAGSLLQVFDAPASSFVAIFLAVLEIWPETTWGMLAPHAYFVHQRTFPDRRSIGWIGFCPHPLRATDFPAATELVDIPGRGTLLLNGREPMDETRREHFERVGEADIKLMELGYLPPLRG

Source Source

Source organism organism	Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
NCBI taxonomy ID ncbi_taxonomy_id	208964
Host organism host_organism	Escherichia coli BL21(DE3)

▶

Unit-cell length a length_a	77.500 Å
Unit-cell length b length_b	77.500 Å
Unit-cell length c length_c	185.900 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 65
Space-group number int_tables_number	170
Crystal system crystal_system	—

Resolution resolution	3.100 Å
Low-resolution limit resolution_low	25.370 Å
R factor r_factor	0.2079
R_work r_work	0.2064
R_free r_free	0.2372

Pseudomonas aeruginosa TseT-TsiT complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tox-REase-5 domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Imm52 domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7dym__assembly_1__model_1

7dym__assembly_1__model_1 | I(q)

7dym__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)

Pseudomonas aeruginosa TseT-TsiT complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tox-REase-5 domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Imm52 domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7dym__assembly_1__model_1

7dym__assembly_1__model_1 | I(q)

7dym__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)