SAXSdb — 9oz0

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Immunity protein 52 domain-containing protein

Pseudomonas aeruginosa

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Tox-REase-5 domain-containing protein × 1 （Q9HXA6） CITRIC ACID × 1 MAGNESIUM ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9HXA5_PSEAE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–239； UniProt 1–239

Tox-REase-5 domain-containing protein

Pseudomonas aeruginosa

UniProt Q9HXA6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Immunity protein 52 domain-containing protein × 1 （Q9HXA5） CITRIC ACID × 1 MAGNESIUM ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9HXA6_PSEAE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–178； UniProt 84–261

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9oz0
Deposition date deposition_date	2025-06-04
Last revision last_revision	2025-06-18
Structure title title	Crystal structure of T6SS effector-immunity complex PA3907-PA3908 from Pseudomonas aeruginosa
Keywords keywords	;effector, immunity, complex, type 6, T6SS, secretion system, Structural Genomics, Center for Structural Biology of Infectious Diseases, CSBID, UNKNOWN FUNCTION ;; UNKNOWN FUNCTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9oz0__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9oz0__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9oz0__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	23.71 Å
Rg (electron density)	22.43 Å
Total Rg	23.43 Å
Atom count	3308
Residues	396
Excluded volume	58459 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9oz0__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Immunity protein 52 domain-containing protein
Molecular weight formula_weight	27516.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	3310

MTDAKAFRRYIFELYFDPARLLELDDDQHLQRIERFLDALAPLHPVLENWYLCGDSLRDALSHNVTEHRQDLAKALSRDRRTRAVELVLWNGEEDPLKGGLSLDYEASGRAVSSRLQLEDAGSLLQVFDAPASSFVAIFLAVLEIWPETTWGMLAPHAYFVHQRTFPDRRSIGWIGFCPHPLRATDFPAATELVDIPGRGTLLLNGREPMDETRREHFERVGEADIKLMELGYLPPLRG

Source Source

Source organism organism	Pseudomonas aeruginosa
NCBI taxonomy ID ncbi_taxonomy_id	287
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Tox-REase-5 domain-containing protein
Molecular weight formula_weight	21014.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

QGRDKDCVECPPSRGEMAIANNGKGHSMSDLSARYQQWVTNFPFPHEWFWSGTWWDGFDEPRCTLLEAKANYAFLFVPLLGVPRPWARAKVKSDLLQKAEVHSDKARPTPPVFVEWHFLQRIVYEYCAAEYLRMGLANLKAFWNPMPGTDEHDDYQETRAKEQEEMKRFCEENPGYCA

Source Source

Source organism organism	Pseudomonas aeruginosa
NCBI taxonomy ID ncbi_taxonomy_id	287
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 non-polymer

Description description	CITRIC ACID
Molecular weight formula_weight	192.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	2

▶

Unit-cell length a length_a	167.329 Å
Unit-cell length b length_b	167.329 Å
Unit-cell length c length_c	167.329 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 41 3 2
Space-group number int_tables_number	213
Crystal system crystal_system	—

Resolution resolution	2.871 Å
Low-resolution limit resolution_low	29.580 Å
R factor r_factor	0.2305
R_work r_work	0.2277
R_free r_free	0.2855

Crystal structure of T6SS effector-immunity complex PA3907-PA3908 from Pseudomonas aeruginosa

1. Protein Identity and Related Structures Protein Identity & Related Structures

Immunity protein 52 domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Tox-REase-5 domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9oz0__assembly_1__model_1

9oz0__assembly_1__model_1 | I(q)

9oz0__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)

Crystal structure of T6SS effector-immunity complex PA3907-PA3908 from Pseudomonas aeruginosa

1. Protein Identity and Related Structures Protein Identity & Related Structures

Immunity protein 52 domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tox-REase-5 domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9oz0__assembly_1__model_1

9oz0__assembly_1__model_1 | I(q)

9oz0__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)