7e6t

Structural insights into the activation of human calcium-sensing receptor

Method: ELECTRON MICROSCOPY D_max: 167.6 Å Quality: SUSPICIOUS

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Extracellular calcium-sensing receptor

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 20–870 Chain B； UniProt 20–870	Not recorded	PO4 PHOSPHATE ION × 2 CA CALCIUM ION × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 TCR CYCLOMETHYLTRYPTOPHAN × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen NITROGEN	Resolution 3.00 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7E6T	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5FBH Crystal structure of the extracellular domain of human calcium sensing receptor with bound Gd3+ Deposited 2015-12-14	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 20–541（522 aa） Fragment：UNP residues 20-541 Chain B 20–541（522 aa） Fragment：UNP residues 20-541	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	GD3 GADOLINIUM ION × 2 MG MAGNESIUM ION × 3 BCT BICARBONATE ION × 2 CL CHLORIDE ION × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 7 TCR CYCLOMETHYLTRYPTOPHAN × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；294 K；10% PEG 8000, 200 mM MgCl2, 10 mM CaCl2 and 100 mM Tris-HCl, 0.5 mM GdCl3	Resolution 2.70 Å R-free 0.236
5FBK Crystal structure of the extracellular domain of human calcium sensing receptor Deposited 2015-12-14	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 20–541（522 aa） Fragment：UNP residues 20-541 Chain B 20–541（522 aa） Fragment：UNP residues 20-541	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	TCR CYCLOMETHYLTRYPTOPHAN × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 8 CL CHLORIDE ION × 6 BCT BICARBONATE ION × 2 MG MAGNESIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；294 K；10% PEG 8000, 200 mM MgCl2, 10 mM CaCl2 and 100 mM Tris-HCl	Resolution 2.10 Å R-free 0.223
5K5S Crystal structure of the active form of human calcium-sensing receptor extracellular domain Deposited 2016-05-23	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 20–607（588 aa） Chain B 20–607（588 aa）	Not recorded	TRP TRYPTOPHAN × 2 PO4 PHOSPHATE ION × 4 CA CALCIUM ION × 8 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；1.6 M NaH2PO4, 0.4 M K2HPO4, 100 mM Na2HPO4/citric acid pH 4.2, 10 mM CaCl2, 10 mM L-Trp	Resolution 2.60 Å R-free 0.222
5K5T Crystal structure of the inactive form of human calcium-sensing receptor extracellular domain Deposited 2016-05-23	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 20–607（588 aa）	Not recorded	CA CALCIUM ION × 2 SO4 SULFATE ION × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 14	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.5 M Li2SO4, 100 mM Tris pH 8.5, 2 mM CaCl2	Resolution 3.10 Å R-free 0.239
5K5T Crystal structure of the inactive form of human calcium-sensing receptor extracellular domain Deposited 2016-05-23	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 20–607（588 aa）	Not recorded	CA CALCIUM ION × 2 SO4 SULFATE ION × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 14	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.5 M Li2SO4, 100 mM Tris pH 8.5, 2 mM CaCl2	Resolution 3.10 Å R-free 0.239
5K5T Crystal structure of the inactive form of human calcium-sensing receptor extracellular domain Deposited 2016-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 20–607（588 aa）	Not recorded	CA CALCIUM ION × 4 SO4 SULFATE ION × 12 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 28	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.5 M Li2SO4, 100 mM Tris pH 8.5, 2 mM CaCl2	Resolution 3.10 Å R-free 0.239
7DTT Human Calcium-Sensing Receptor bound with calcium ions Deposited 2021-01-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 20–1078（1059 aa） Chain B 20–1078（1059 aa）	Not recorded	CA CALCIUM ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
7DTU Human Calcium-Sensing Receptor bound with L-Trp Deposited 2021-01-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 20–1078（1059 aa） Chain B 20–1078（1059 aa）	Not recorded	TRP TRYPTOPHAN × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å
7DTV Human Calcium-Sensing Receptor bound with L-Trp and calcium ions Deposited 2021-01-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 20–1078（1059 aa） Chain B 20–1078（1059 aa）	Not recorded	TRP TRYPTOPHAN × 2 CA CALCIUM ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7DTW Human Calcium-Sensing Receptor in the inactive close-close conformation Deposited 2021-01-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 20–1078（1059 aa） Chain B 20–1078（1059 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.50 Å
7E6U the complex of inactive CaSR and NB2D11 Deposited 2021-02-24	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 20–870（851 aa） Chain C 20–870（851 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 6.00 Å
7M3E Asymmetric Activation of the Calcium Sensing Receptor Homodimer Deposited 2021-03-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 20–894（875 aa） Chain B 20–894（875 aa）	Not recorded	YP1 2-chloro-6-[(2R)-2-hydroxy-3-{[2-methyl-1-(naphthalen-2-yl)propan-2-yl]amino}propoxy]benzonitrile × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9 TRP TRYPTOPHAN × 2 CA CALCIUM ION × 4 PO4 PHOSPHATE ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
7M3F Asymmetric Activation of the Calcium Sensing Receptor Homodimer Deposited 2021-03-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 20–894（875 aa） Chain B 20–894（875 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9 YP4 N-[(1R)-1-(naphthalen-1-yl)ethyl]-3-[3-(trifluoromethyl)phenyl]propan-1-amine × 2 TRP TRYPTOPHAN × 2 CA CALCIUM ION × 4 PO4 PHOSPHATE ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
7M3G Asymmetric Activation of the Calcium Sensing Receptor Homodimer Deposited 2021-03-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 20–894（875 aa） Chain B 20–894（875 aa）	Not recorded	H43 2-[4-[(3S)-3-[[(1R)-1-naphthalen-1-ylethyl]amino]pyrrolidin-1-yl]phenyl]ethanoic acid × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 TRP TRYPTOPHAN × 2 CA CALCIUM ION × 4 PO4 PHOSPHATE ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
7M3J Asymmetric Activation of the Calcium Sensing Receptor Homodimer Deposited 2021-03-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 20–894（875 aa） Chain B 20–894（875 aa）	Not recorded	YP1 2-chloro-6-[(2R)-2-hydroxy-3-{[2-methyl-1-(naphthalen-2-yl)propan-2-yl]amino}propoxy]benzonitrile × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 PO4 PHOSPHATE ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
8SZF Cryo-EM structure of cinacalcet-bound active-state human calcium-sensing receptor CaSR in lipid nanodiscs Deposited 2023-05-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 19–894（876 aa） Chain B 19–894（876 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 TRP TRYPTOPHAN × 2 CA CALCIUM ION × 4 PO4 PHOSPHATE ION × 2 YP4 N-[(1R)-1-(naphthalen-1-yl)ethyl]-3-[3-(trifluoromethyl)phenyl]propan-1-amine × 2 SPM SPERMINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
8SZG Cryo-EM structure of cinacalcet-bound human calcium-sensing receptor CaSR-Gq complex in lipid nanodiscs Deposited 2023-05-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 19–894（876 aa） Chain B 19–894（876 aa）	Not recorded	YP4 N-[(1R)-1-(naphthalen-1-yl)ethyl]-3-[3-(trifluoromethyl)phenyl]propan-1-amine × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 SPM SPERMINE × 3 CA CALCIUM ION × 3 TRP TRYPTOPHAN × 2 PO4 PHOSPHATE ION × 2 CLR CHOLESTEROL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8SZH Cryo-EM structure of cinacalcet-bound human calcium-sensing receptor CaSR-Gi complex in lipid nanodiscs Deposited 2023-05-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 19–894（876 aa） Chain B 19–894（876 aa）	Not recorded	YP4 N-[(1R)-1-(naphthalen-1-yl)ethyl]-3-[3-(trifluoromethyl)phenyl]propan-1-amine × 2 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 CA CALCIUM ION × 4 TRP TRYPTOPHAN × 2 PO4 PHOSPHATE ION × 2 SPM SPERMINE × 4 CLR CHOLESTEROL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
8SZI Cryo-EM structure of PAM-free human calcium-sensing receptor CaSR-Gi complex in lipid nanodiscs Deposited 2023-05-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 19–894（876 aa） Chain B 19–894（876 aa）	Not recorded	PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 CA CALCIUM ION × 4 TRP TRYPTOPHAN × 3 PO4 PHOSPHATE ION × 2 CLR CHOLESTEROL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8WPG Human calcium-sensing receptor bound with cinacalcet in detergent Deposited 2023-10-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 20–892（873 aa） Chain B 20–892（873 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 TRP TRYPTOPHAN × 2 CA CALCIUM ION × 4 PO4 PHOSPHATE ION × 2 YP4 N-[(1R)-1-(naphthalen-1-yl)ethyl]-3-[3-(trifluoromethyl)phenyl]propan-1-amine × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
8WPU Human calcium-sensing receptor(CaSR) bound to cinacalcet in complex with Gq protein Deposited 2023-10-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 20–892（873 aa） Chain B 20–892（873 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9 YP4 N-[(1R)-1-(naphthalen-1-yl)ethyl]-3-[3-(trifluoromethyl)phenyl]propan-1-amine × 2 TRP TRYPTOPHAN × 2 CA CALCIUM ION × 4 PO4 PHOSPHATE ION × 2 CLR CHOLESTEROL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9ASB Structure of human calcium-sensing receptor in complex with chimeric Gq (miniGisq) protein in nanodiscs Deposited 2024-02-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain Q 1–903（903 aa） Chain R 1–903（903 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 TCR CYCLOMETHYLTRYPTOPHAN × 2 PO4 PHOSPHATE ION × 2 CA CALCIUM ION × 6 9IG 3-(2-chlorophenyl)-N-[(1R)-1-(3-methoxyphenyl)ethyl]propan-1-amine × 2 Y01 CHOLESTEROL HEMISUCCINATE × 1 A1AF7 (19R,22S,25R)-22,25,26-trihydroxy-16,22-dioxo-17,21,23-trioxa-22lambda~5~-phosphahexacosan-19-yl (9Z)-octadec-9-enoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；The sample was blotted for 6s before plunge-frozen.	Resolution 3.40 Å
9AVG Structure of human calcium-sensing receptor in complex with chimeric Gs (miniGis) protein in nanodiscs Deposited 2024-03-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain Q 1–903（903 aa） Chain R 1–903（903 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 TCR CYCLOMETHYLTRYPTOPHAN × 2 PO4 PHOSPHATE ION × 2 CA CALCIUM ION × 6 9IG 3-(2-chlorophenyl)-N-[(1R)-1-(3-methoxyphenyl)ethyl]propan-1-amine × 2 Y01 CHOLESTEROL HEMISUCCINATE × 1 A1AF7 (19R,22S,25R)-22,25,26-trihydroxy-16,22-dioxo-17,21,23-trioxa-22lambda~5~-phosphahexacosan-19-yl (9Z)-octadec-9-enoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；The sample was blotted for 6s before plunge-frozen.	Resolution 3.60 Å
9AVL Structure of human calcium-sensing receptor in complex with Gi3 protein in nanodiscs Deposited 2024-03-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain Q 1–903（903 aa） Chain R 1–903（903 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 TCR CYCLOMETHYLTRYPTOPHAN × 2 PO4 PHOSPHATE ION × 2 CA CALCIUM ION × 6 9IG 3-(2-chlorophenyl)-N-[(1R)-1-(3-methoxyphenyl)ethyl]propan-1-amine × 2 Y01 CHOLESTEROL HEMISUCCINATE × 1 A1AF7 (19R,22S,25R)-22,25,26-trihydroxy-16,22-dioxo-17,21,23-trioxa-22lambda~5~-phosphahexacosan-19-yl (9Z)-octadec-9-enoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；The sample was blotted for 6s before plunge-frozen.	Resolution 3.80 Å
9AXF Structure of human calcium-sensing receptor in complex with chimeric Gq (miniGisq) protein in detergent Deposited 2024-03-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 7 PDB declaration: heptameric	Chain Q 1–903（903 aa） Chain R 1–903（903 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 8 TCR CYCLOMETHYLTRYPTOPHAN × 2 PO4 PHOSPHATE ION × 2 CA CALCIUM ION × 7 9IG 3-(2-chlorophenyl)-N-[(1R)-1-(3-methoxyphenyl)ethyl]propan-1-amine × 2 AV0 Lauryl Maltose Neopentyl Glycol × 1 Y01 CHOLESTEROL HEMISUCCINATE × 4 CLR CHOLESTEROL × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；The sample was blotted for 6s before plunge-frozen.	Resolution 3.50 Å
9AYF Structure of human calcium-sensing receptor in complex with Gi1 (miniGi1) protein in detergent Deposited 2024-03-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain Q 1–903（903 aa） Chain R 1–903（903 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 TCR CYCLOMETHYLTRYPTOPHAN × 2 PO4 PHOSPHATE ION × 2 CA CALCIUM ION × 8 9IG 3-(2-chlorophenyl)-N-[(1R)-1-(3-methoxyphenyl)ethyl]propan-1-amine × 2 AV0 Lauryl Maltose Neopentyl Glycol × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；The sample was blotted for 6s before plunge-frozen.	Resolution 3.60 Å
9C1P Structure of Calcium-Sensing Receptor in complex with positive allosteric modulator '6218 Deposited 2024-05-29	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 19–894（876 aa） Chain B 19–894（876 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 CA CALCIUM ION × 8 TRP TRYPTOPHAN × 2 PO4 PHOSPHATE ION × 2 A1ATP (5R)-N-[2-(1,2-benzothiazol-3-yl)ethyl]-1-methyl-2,3,4,5-tetrahydro-1H-1-benzazepin-5-amine × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9C2F Structure of Calcium-Sensing Receptor in complex with positive allosteric modulator '54149 Deposited 2024-05-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 19–894（876 aa） Chain B 19–894（876 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 CA CALCIUM ION × 8 TRP TRYPTOPHAN × 2 PO4 PHOSPHATE ION × 2 A1ATX (1R)-1-(2H-1,3-benzodioxol-4-yl)-N-[2-(1,2-benzothiazol-3-yl)ethyl]ethan-1-amine × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9J7I Cryo-EM Structure of calcium sensing receptor in complex gamma-glutamyl-valyl-glycine as a kokumi substance Deposited 2024-08-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 19–894（876 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.55 Å
9J7I Cryo-EM Structure of calcium sensing receptor in complex gamma-glutamyl-valyl-glycine as a kokumi substance Deposited 2024-08-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 19–894（876 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.55 Å
9J7I Cryo-EM Structure of calcium sensing receptor in complex gamma-glutamyl-valyl-glycine as a kokumi substance Deposited 2024-08-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 19–894（876 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.55 Å

27 other PDB entries and 31 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CASR_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–851； UniProt 20–870 Author chain B； PDBConstruct 1–851； UniProt 20–870

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7e6t
Deposition date deposition_date	2021-02-24
Structure title title	Structural insights into the activation of human calcium-sensing receptor
Keywords keywords	;G-protein-coupled receptor (GPCR); Calcium-sensing receptor (CaSR); cryo-electron microscopy (cryo-EM); calcium ions; nanobody, STRUCTURAL PROTEIN ;; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	53.80 Å
Radius of gyration Rg (electron density) rg_electron	56.40 Å
Forward intensity I(0) i0	435772000.00
Molecular weight molecular_weight	180800.0 kDa
Excluded volume excluded_volume	228930 Å³
Envelope volume envelope_volume	349260 Å³
Hydration-shell volume shell_volume	55955 Å³
Envelope diameter envelope_diameter	179.3 Å
Shell Rg shell_rg	50.91 Å
Envelope Rg envelope_rg	56.03 Å
Shape Rg shape_rg	56.39 Å
Total Rg total_rg	56.23 Å
Total atoms total_atoms	12741
Residues n_residues	1589
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	167.6 Å
Rg (real space) rg_real	54.52 Å
Rg uncertainty (real space) rg_real_error	1.67 Å
I(0) (real space) i0_real	4.3580e+08
I(0) uncertainty (real space) i0_real_error	8.1020e+06
Rg (reciprocal space) rg_reciprocal	53.16 Å
I(0) (reciprocal space) i0_reciprocal	434900000.0000
Solution quality estimate total_estimate	0.4807
Solution quality rating solution_quality	SUSPICIOUS a SUSPICIOUS solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	40.5 Å
Skewness Skewness skewness	0.570
Kurtosis Kurtosis kurtosis	-0.708
Angular range angular_range	— – 0.1450 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	44470000.0000
Real-space data points n_real_points	30
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.506; Stabil: 0.996; Sysdev: 0.017; Positv: 1.000; Valcen: 0.687; Smooth: 0.001

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Extracellular calcium-sensing receptor
Molecular weight formula_weight	97326.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,A
Atom count atom_count	12741

YGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKIDSLNLDEFCNCSEHIPSTIAVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQFKSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKEFWEETFNCHLQEGAKGPLPVDTFLRGHEESGDRFSNSSTAFRPLCTGDENISSVETPYIDYTHLRISYNVYLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFDECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVPFSNCSRDCLAGTRKGIIEGEPTCCFECVECPDGEYSDETDASACNKCPDDFWSNENHTSCIAKEIEFLSWTEPFGIALTLFAVLGIFLTAFVLGVFIKFRNTPIVKATNRELSYLLLFSLLCCFSSSLFFIGEPQDWTCRLRQPAFGISFVLCISCILVKTNRVLLVFEAKIPTSFHRKWWGLNLQFLLVFLCTFMQIVICVIWLYTAPPSSYRNQELEDEIIFITCHEGSLMALGFLIGYTCLLAAICFFFAFKSRKLPENFNEAKFITFSMLIFFIVWISFIPAYASTYGKFVSAVEVIAILAASFGLLACIFFNKIYIILFKPSRNTIEAAADYKDDDDK

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 2 Entity 2 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 4 Entity 4 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 5 Entity 5 non-polymer

Description description	CYCLOMETHYLTRYPTOPHAN
Molecular weight formula_weight	216.2 kDa
Source method src_method	syn
Copy count entity_count	2

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.000 Å
Low-resolution limit resolution_low	353.600 Å
R factor r_factor	0.5050
R_work r_work	0.5050
R_free r_free	—

Resolution resolution	3.00 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	248900

fit	/app/data/saxs_computation/e6/7e6t/7e6t.fit
pddf	/app/data/pr_computation/e6/7e6t/7e6t.pr.out
profile	/app/data/saxs_computation/e6/7e6t/7e6t.dat