7eyd

Cryo-EM structure of cyanobacterial phycobilisome from Anabaena sp. PCC 7120

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phycobilisome rod-core linker polypeptide CpcG2

Nostoc sp. PCC 7120 = FACHB-418

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 288	C-phycocyanin alpha subunit × 84 （P07121） C-phycocyanin beta subunit × 84 （P07120） Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod × 8 （P07123） Phycobilisome rod-core linker polypeptide CpcG4 × 4 （P29989） Phycobilisome rod-core linker polypeptide CpcG1 × 2 （P29986） Allophycocyanin subunit alpha 1 × 44 （P80555） Allophycocyanin subunit beta × 46 （P80557） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 8 （P80558） Phycobiliprotein ApcE × 2 （P80559） Allophycocyanin subunit beta-18 × 2 （Q7A2D6） Allophycocyanin subunit alpha-B × 2 （P80556） PHYCOCYANOBILIN × 348	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PYG2_NOSS1
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A1； PDBConstruct 1–247； UniProt 1–247 Author chain A4； PDBConstruct 1–247； UniProt 1–247

C-phycocyanin alpha subunit

Nostoc sp. PCC 7120 = FACHB-418

UniProt P07121

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 288	Phycobilisome rod-core linker polypeptide CpcG2 × 2 （P29987） C-phycocyanin beta subunit × 84 （P07120） Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod × 8 （P07123） Phycobilisome rod-core linker polypeptide CpcG4 × 4 （P29989） Phycobilisome rod-core linker polypeptide CpcG1 × 2 （P29986） Allophycocyanin subunit alpha 1 × 44 （P80555） Allophycocyanin subunit beta × 46 （P80557） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 8 （P80558） Phycobiliprotein ApcE × 2 （P80559） Allophycocyanin subunit beta-18 × 2 （Q7A2D6） Allophycocyanin subunit alpha-B × 2 （P80556） PHYCOCYANOBILIN × 348	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHCA_NOSS1
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B1； PDBConstruct 1–163； UniProt 1–163 Author chain B2； PDBConstruct 1–163； UniProt 1–163 Author chain B3； PDBConstruct 1–163； UniProt 1–163 Author chain B4； PDBConstruct 1–163； UniProt 1–163 Author chain B5； PDBConstruct 1–163； UniProt 1–163 Author chain B6； PDBConstruct 1–163； UniProt 1–163 Author chain B7； PDBConstruct 1–163； UniProt 1–163 Author chain BA； PDBConstruct 1–163； UniProt 1–163 Author chain D1； PDBConstruct 1–163； UniProt 1–163 Author chain D2； PDBConstruct 1–163； UniProt 1–163 Author chain D3； PDBConstruct 1–163； UniProt 1–163 Author chain D4； PDBConstruct 1–163； UniProt 1–163 Author chain D5； PDBConstruct 1–163； UniProt 1–163 Author chain D6； PDBConstruct 1–163； UniProt 1–163 Author chain D7； PDBConstruct 1–163； UniProt 1–163 Author chain DA； PDBConstruct 1–163； UniProt 1–163 Author chain F1； PDBConstruct 1–163； UniProt 1–163 Author chain F2； PDBConstruct 1–163； UniProt 1–163 Author chain F3； PDBConstruct 1–163； UniProt 1–163 Author chain F4； PDBConstruct 1–163； UniProt 1–163 Author chain F5； PDBConstruct 1–163； UniProt 1–163 Author chain F6； PDBConstruct 1–163； UniProt 1–163 Author chain F7； PDBConstruct 1–163； UniProt 1–163 Author chain FA； PDBConstruct 1–163； UniProt 1–163 Author chain H1； PDBConstruct 1–163； UniProt 1–163 Author chain H2； PDBConstruct 1–163； UniProt 1–163 Author chain H3； PDBConstruct 1–163； UniProt 1–163 Author chain H4； PDBConstruct 1–163； UniProt 1–163 Author chain H5； PDBConstruct 1–163； UniProt 1–163 Author chain H6； PDBConstruct 1–163； UniProt 1–163 Author chain H7； PDBConstruct 1–163； UniProt 1–163 Author chain HA； PDBConstruct 1–163； UniProt 1–163 Author chain J1； PDBConstruct 1–163； UniProt 1–163 Author chain J2； PDBConstruct 1–163； UniProt 1–163 Author chain J3； PDBConstruct 1–163； UniProt 1–163 Author chain J4； PDBConstruct 1–163； UniProt 1–163 Author chain J5； PDBConstruct 1–163； UniProt 1–163 Author chain J6； PDBConstruct 1–163； UniProt 1–163 Author chain J7； PDBConstruct 1–163； UniProt 1–163 Author chain JA； PDBConstruct 1–163； UniProt 1–163 Author chain L1； PDBConstruct 1–163； UniProt 1–163 Author chain L2； PDBConstruct 1–163； UniProt 1–163 Author chain L3； PDBConstruct 1–163； UniProt 1–163 Author chain L4； PDBConstruct 1–163； UniProt 1–163 Author chain L5； PDBConstruct 1–163； UniProt 1–163 Author chain L6； PDBConstruct 1–163； UniProt 1–163 Author chain L7； PDBConstruct 1–163； UniProt 1–163 Author chain LA； PDBConstruct 1–163； UniProt 1–163 Author chain O1； PDBConstruct 1–163； UniProt 1–163 Author chain O2； PDBConstruct 1–163； UniProt 1–163 Author chain O4； PDBConstruct 1–163； UniProt 1–163 Author chain O5； PDBConstruct 1–163； UniProt 1–163 Author chain O6； PDBConstruct 1–163； UniProt 1–163 Author chain OA； PDBConstruct 1–163； UniProt 1–163 Author chain Q1； PDBConstruct 1–163； UniProt 1–163 Author chain Q2； PDBConstruct 1–163； UniProt 1–163 Author chain Q4； PDBConstruct 1–163； UniProt 1–163 Author chain Q5； PDBConstruct 1–163； UniProt 1–163 Author chain Q6； PDBConstruct 1–163； UniProt 1–163 Author chain QA； PDBConstruct 1–163； UniProt 1–163 Author chain S1； PDBConstruct 1–163； UniProt 1–163 Author chain S2； PDBConstruct 1–163； UniProt 1–163 Author chain S4； PDBConstruct 1–163； UniProt 1–163 Author chain S5； PDBConstruct 1–163； UniProt 1–163 Author chain S6； PDBConstruct 1–163； UniProt 1–163 Author chain SA； PDBConstruct 1–163； UniProt 1–163 Author chain U1； PDBConstruct 1–163； UniProt 1–163 Author chain U2； PDBConstruct 1–163； UniProt 1–163 Author chain U4； PDBConstruct 1–163； UniProt 1–163 Author chain U5； PDBConstruct 1–163； UniProt 1–163 Author chain U6； PDBConstruct 1–163； UniProt 1–163 Author chain UA； PDBConstruct 1–163； UniProt 1–163 Author chain W1； PDBConstruct 1–163； UniProt 1–163 Author chain W2； PDBConstruct 1–163； UniProt 1–163 Author chain W4； PDBConstruct 1–163； UniProt 1–163 Author chain W5； PDBConstruct 1–163； UniProt 1–163 Author chain W6； PDBConstruct 1–163； UniProt 1–163 Author chain WA； PDBConstruct 1–163； UniProt 1–163 Author chain Y1； PDBConstruct 1–163； UniProt 1–163 Author chain Y2； PDBConstruct 1–163； UniProt 1–163 Author chain Y4； PDBConstruct 1–163； UniProt 1–163 Author chain Y5； PDBConstruct 1–163； UniProt 1–163 Author chain Y6； PDBConstruct 1–163； UniProt 1–163 Author chain YA； PDBConstruct 1–163； UniProt 1–163

C-phycocyanin beta subunit

Nostoc sp. PCC 7120 = FACHB-418

UniProt P07120

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 288	Phycobilisome rod-core linker polypeptide CpcG2 × 2 （P29987） C-phycocyanin alpha subunit × 84 （P07121） Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod × 8 （P07123） Phycobilisome rod-core linker polypeptide CpcG4 × 4 （P29989） Phycobilisome rod-core linker polypeptide CpcG1 × 2 （P29986） Allophycocyanin subunit alpha 1 × 44 （P80555） Allophycocyanin subunit beta × 46 （P80557） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 8 （P80558） Phycobiliprotein ApcE × 2 （P80559） Allophycocyanin subunit beta-18 × 2 （Q7A2D6） Allophycocyanin subunit alpha-B × 2 （P80556） PHYCOCYANOBILIN × 348	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHCB_NOSS1
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C1； PDBConstruct 1–173； UniProt 1–173 Author chain C2； PDBConstruct 1–173； UniProt 1–173 Author chain C3； PDBConstruct 1–173； UniProt 1–173 Author chain C4； PDBConstruct 1–173； UniProt 1–173 Author chain C5； PDBConstruct 1–173； UniProt 1–173 Author chain C6； PDBConstruct 1–173； UniProt 1–173 Author chain C7； PDBConstruct 1–173； UniProt 1–173 Author chain CA； PDBConstruct 1–173； UniProt 1–173 Author chain E1； PDBConstruct 1–173； UniProt 1–173 Author chain E2； PDBConstruct 1–173； UniProt 1–173 Author chain E3； PDBConstruct 1–173； UniProt 1–173 Author chain E4； PDBConstruct 1–173； UniProt 1–173 Author chain E5； PDBConstruct 1–173； UniProt 1–173 Author chain E6； PDBConstruct 1–173； UniProt 1–173 Author chain E7； PDBConstruct 1–173； UniProt 1–173 Author chain EA； PDBConstruct 1–173； UniProt 1–173 Author chain G1； PDBConstruct 1–173； UniProt 1–173 Author chain G2； PDBConstruct 1–173； UniProt 1–173 Author chain G3； PDBConstruct 1–173； UniProt 1–173 Author chain G4； PDBConstruct 1–173； UniProt 1–173 Author chain G5； PDBConstruct 1–173； UniProt 1–173 Author chain G6； PDBConstruct 1–173； UniProt 1–173 Author chain G7； PDBConstruct 1–173； UniProt 1–173 Author chain GA； PDBConstruct 1–173； UniProt 1–173 Author chain I1； PDBConstruct 1–173； UniProt 1–173 Author chain I2； PDBConstruct 1–173； UniProt 1–173 Author chain I3； PDBConstruct 1–173； UniProt 1–173 Author chain I4； PDBConstruct 1–173； UniProt 1–173 Author chain I5； PDBConstruct 1–173； UniProt 1–173 Author chain I6； PDBConstruct 1–173； UniProt 1–173 Author chain I7； PDBConstruct 1–173； UniProt 1–173 Author chain IA； PDBConstruct 1–173； UniProt 1–173 Author chain K1； PDBConstruct 1–173； UniProt 1–173 Author chain K2； PDBConstruct 1–173； UniProt 1–173 Author chain K3； PDBConstruct 1–173； UniProt 1–173 Author chain K4； PDBConstruct 1–173； UniProt 1–173 Author chain K5； PDBConstruct 1–173； UniProt 1–173 Author chain K6； PDBConstruct 1–173； UniProt 1–173 Author chain K7； PDBConstruct 1–173； UniProt 1–173 Author chain KA； PDBConstruct 1–173； UniProt 1–173 Author chain M1； PDBConstruct 1–173； UniProt 1–173 Author chain M2； PDBConstruct 1–173； UniProt 1–173 Author chain M3； PDBConstruct 1–173； UniProt 1–173 Author chain M4； PDBConstruct 1–173； UniProt 1–173 Author chain M5； PDBConstruct 1–173； UniProt 1–173 Author chain M6； PDBConstruct 1–173； UniProt 1–173 Author chain M7； PDBConstruct 1–173； UniProt 1–173 Author chain MA； PDBConstruct 1–173； UniProt 1–173 Author chain P1； PDBConstruct 1–173； UniProt 1–173 Author chain P2； PDBConstruct 1–173； UniProt 1–173 Author chain P4； PDBConstruct 1–173； UniProt 1–173 Author chain P5； PDBConstruct 1–173； UniProt 1–173 Author chain P6； PDBConstruct 1–173； UniProt 1–173 Author chain PA； PDBConstruct 1–173； UniProt 1–173 Author chain R1； PDBConstruct 1–173； UniProt 1–173 Author chain R2； PDBConstruct 1–173； UniProt 1–173 Author chain R4； PDBConstruct 1–173； UniProt 1–173 Author chain R5； PDBConstruct 1–173； UniProt 1–173 Author chain R6； PDBConstruct 1–173； UniProt 1–173 Author chain RA； PDBConstruct 1–173； UniProt 1–173 Author chain T1； PDBConstruct 1–173； UniProt 1–173 Author chain T2； PDBConstruct 1–173； UniProt 1–173 Author chain T4； PDBConstruct 1–173； UniProt 1–173 Author chain T5； PDBConstruct 1–173； UniProt 1–173 Author chain T6； PDBConstruct 1–173； UniProt 1–173 Author chain TA； PDBConstruct 1–173； UniProt 1–173 Author chain V1； PDBConstruct 1–173； UniProt 1–173 Author chain V2； PDBConstruct 1–173； UniProt 1–173 Author chain V4； PDBConstruct 1–173； UniProt 1–173 Author chain V5； PDBConstruct 1–173； UniProt 1–173 Author chain V6； PDBConstruct 1–173； UniProt 1–173 Author chain VA； PDBConstruct 1–173； UniProt 1–173 Author chain X1； PDBConstruct 1–173； UniProt 1–173 Author chain X2； PDBConstruct 1–173； UniProt 1–173 Author chain X4； PDBConstruct 1–173； UniProt 1–173 Author chain X5； PDBConstruct 1–173； UniProt 1–173 Author chain X6； PDBConstruct 1–173； UniProt 1–173 Author chain XA； PDBConstruct 1–173； UniProt 1–173 Author chain Z1； PDBConstruct 1–173； UniProt 1–173 Author chain Z2； PDBConstruct 1–173； UniProt 1–173 Author chain Z4； PDBConstruct 1–173； UniProt 1–173 Author chain Z5； PDBConstruct 1–173； UniProt 1–173 Author chain Z6； PDBConstruct 1–173； UniProt 1–173 Author chain ZA； PDBConstruct 1–173； UniProt 1–173

Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod

Nostoc sp. PCC 7120 = FACHB-418

UniProt P07123

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 288	Phycobilisome rod-core linker polypeptide CpcG2 × 2 （P29987） C-phycocyanin alpha subunit × 84 （P07121） C-phycocyanin beta subunit × 84 （P07120） Phycobilisome rod-core linker polypeptide CpcG4 × 4 （P29989） Phycobilisome rod-core linker polypeptide CpcG1 × 2 （P29986） Allophycocyanin subunit alpha 1 × 44 （P80555） Allophycocyanin subunit beta × 46 （P80557） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 8 （P80558） Phycobiliprotein ApcE × 2 （P80559） Allophycocyanin subunit beta-18 × 2 （Q7A2D6） Allophycocyanin subunit alpha-B × 2 （P80556） PHYCOCYANOBILIN × 348	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PYR1_NOSS1
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain N1； PDBConstruct 1–286； UniProt 1–286 Author chain N2； PDBConstruct 1–286； UniProt 1–286 Author chain N3； PDBConstruct 1–286； UniProt 1–286 Author chain N4； PDBConstruct 1–286； UniProt 1–286 Author chain N5； PDBConstruct 1–286； UniProt 1–286 Author chain N6； PDBConstruct 1–286； UniProt 1–286 Author chain N7； PDBConstruct 1–286； UniProt 1–286 Author chain NA； PDBConstruct 1–286； UniProt 1–286

Phycobilisome rod-core linker polypeptide CpcG4

Nostoc sp. PCC 7120 = FACHB-418

UniProt P29989

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 288	Phycobilisome rod-core linker polypeptide CpcG2 × 2 （P29987） C-phycocyanin alpha subunit × 84 （P07121） C-phycocyanin beta subunit × 84 （P07120） Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod × 8 （P07123） Phycobilisome rod-core linker polypeptide CpcG1 × 2 （P29986） Allophycocyanin subunit alpha 1 × 44 （P80555） Allophycocyanin subunit beta × 46 （P80557） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 8 （P80558） Phycobiliprotein ApcE × 2 （P80559） Allophycocyanin subunit beta-18 × 2 （Q7A2D6） Allophycocyanin subunit alpha-B × 2 （P80556） PHYCOCYANOBILIN × 348	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PYG4_NOSS1
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain A2； PDBConstruct 1–253； UniProt 1–253 Author chain A5； PDBConstruct 1–253； UniProt 1–253 Author chain A6； PDBConstruct 1–253； UniProt 1–253 Author chain AA； PDBConstruct 1–253； UniProt 1–253

Phycobilisome rod-core linker polypeptide CpcG1

Nostoc sp. PCC 7120 = FACHB-418

UniProt P29986

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 288	Phycobilisome rod-core linker polypeptide CpcG2 × 2 （P29987） C-phycocyanin alpha subunit × 84 （P07121） C-phycocyanin beta subunit × 84 （P07120） Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod × 8 （P07123） Phycobilisome rod-core linker polypeptide CpcG4 × 4 （P29989） Allophycocyanin subunit alpha 1 × 44 （P80555） Allophycocyanin subunit beta × 46 （P80557） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 8 （P80558） Phycobiliprotein ApcE × 2 （P80559） Allophycocyanin subunit beta-18 × 2 （Q7A2D6） Allophycocyanin subunit alpha-B × 2 （P80556） PHYCOCYANOBILIN × 348	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PYG1_NOSS1
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain A3； PDBConstruct 1–279； UniProt 1–279 Author chain A7； PDBConstruct 1–279； UniProt 1–279

Allophycocyanin subunit alpha 1

Nostoc sp. PCC 7120 = FACHB-418

UniProt P80555

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 288	Phycobilisome rod-core linker polypeptide CpcG2 × 2 （P29987） C-phycocyanin alpha subunit × 84 （P07121） C-phycocyanin beta subunit × 84 （P07120） Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod × 8 （P07123） Phycobilisome rod-core linker polypeptide CpcG4 × 4 （P29989） Phycobilisome rod-core linker polypeptide CpcG1 × 2 （P29986） Allophycocyanin subunit beta × 46 （P80557） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 8 （P80558） Phycobiliprotein ApcE × 2 （P80559） Allophycocyanin subunit beta-18 × 2 （Q7A2D6） Allophycocyanin subunit alpha-B × 2 （P80556） PHYCOCYANOBILIN × 348	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHAA1_NOSS1
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain A8； PDBConstruct 1–161； UniProt 1–161 Author chain A9； PDBConstruct 1–161； UniProt 1–161 Author chain C8； PDBConstruct 1–161； UniProt 1–161 Author chain C9； PDBConstruct 1–161； UniProt 1–161 Author chain E8； PDBConstruct 1–161； UniProt 1–161 Author chain E9； PDBConstruct 1–161； UniProt 1–161 Author chain G9； PDBConstruct 1–161； UniProt 1–161 Author chain H8； PDBConstruct 1–161； UniProt 1–161 Author chain I9； PDBConstruct 1–161； UniProt 1–161 Author chain J8； PDBConstruct 1–161； UniProt 1–161 Author chain K9； PDBConstruct 1–161； UniProt 1–161 Author chain L8； PDBConstruct 1–161； UniProt 1–161 Author chain N9； PDBConstruct 1–161； UniProt 1–161 Author chain O8； PDBConstruct 1–161； UniProt 1–161 Author chain P9； PDBConstruct 1–161； UniProt 1–161 Author chain Q8； PDBConstruct 1–161； UniProt 1–161 Author chain R9； PDBConstruct 1–161； UniProt 1–161 Author chain S8； PDBConstruct 1–161； UniProt 1–161 Author chain T9； PDBConstruct 1–161； UniProt 1–161 Author chain V8； PDBConstruct 1–161； UniProt 1–161 Author chain X8； PDBConstruct 1–161； UniProt 1–161 Author chain X9； PDBConstruct 1–161； UniProt 1–161 Author chain Z8； PDBConstruct 1–161； UniProt 1–161 Author chain Z9； PDBConstruct 1–161； UniProt 1–161 Author chain b9； PDBConstruct 1–161； UniProt 1–161 Author chain c8； PDBConstruct 1–161； UniProt 1–161 Author chain d9； PDBConstruct 1–161； UniProt 1–161 Author chain e8； PDBConstruct 1–161； UniProt 1–161 Author chain f9； PDBConstruct 1–161； UniProt 1–161 Author chain g8； PDBConstruct 1–161； UniProt 1–161 Author chain i9； PDBConstruct 1–161； UniProt 1–161 Author chain j8； PDBConstruct 1–161； UniProt 1–161 Author chain k9； PDBConstruct 1–161； UniProt 1–161 Author chain l8； PDBConstruct 1–161； UniProt 1–161 Author chain n8； PDBConstruct 1–161； UniProt 1–161 Author chain o9； PDBConstruct 1–161； UniProt 1–161 Author chain p8； PDBConstruct 1–161； UniProt 1–161 Author chain q9； PDBConstruct 1–161； UniProt 1–161 Author chain r8； PDBConstruct 1–161； UniProt 1–161 Author chain s9； PDBConstruct 1–161； UniProt 1–161 Author chain t8； PDBConstruct 1–161； UniProt 1–161 Author chain u9； PDBConstruct 1–161； UniProt 1–161 Author chain w9； PDBConstruct 1–161； UniProt 1–161 Author chain y9； PDBConstruct 1–161； UniProt 1–161

Allophycocyanin subunit beta

Nostoc sp. PCC 7120 = FACHB-418

UniProt P80557

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 288	Phycobilisome rod-core linker polypeptide CpcG2 × 2 （P29987） C-phycocyanin alpha subunit × 84 （P07121） C-phycocyanin beta subunit × 84 （P07120） Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod × 8 （P07123） Phycobilisome rod-core linker polypeptide CpcG4 × 4 （P29989） Phycobilisome rod-core linker polypeptide CpcG1 × 2 （P29986） Allophycocyanin subunit alpha 1 × 44 （P80555） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 8 （P80558） Phycobiliprotein ApcE × 2 （P80559） Allophycocyanin subunit beta-18 × 2 （Q7A2D6） Allophycocyanin subunit alpha-B × 2 （P80556） PHYCOCYANOBILIN × 348	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APCB_NOSS1
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain B8； PDBConstruct 1–162； UniProt 1–162 Author chain B9； PDBConstruct 1–162； UniProt 1–162 Author chain D8； PDBConstruct 1–162； UniProt 1–162 Author chain D9； PDBConstruct 1–162； UniProt 1–162 Author chain F8； PDBConstruct 1–162； UniProt 1–162 Author chain F9； PDBConstruct 1–162； UniProt 1–162 Author chain H9； PDBConstruct 1–162； UniProt 1–162 Author chain I8； PDBConstruct 1–162； UniProt 1–162 Author chain J9； PDBConstruct 1–162； UniProt 1–162 Author chain K8； PDBConstruct 1–162； UniProt 1–162 Author chain L9； PDBConstruct 1–162； UniProt 1–162 Author chain M8； PDBConstruct 1–162； UniProt 1–162 Author chain M9； PDBConstruct 1–162； UniProt 1–162 Author chain O9； PDBConstruct 1–162； UniProt 1–162 Author chain P8； PDBConstruct 1–162； UniProt 1–162 Author chain R8； PDBConstruct 1–162； UniProt 1–162 Author chain S9； PDBConstruct 1–162； UniProt 1–162 Author chain T8； PDBConstruct 1–162； UniProt 1–162 Author chain U9； PDBConstruct 1–162； UniProt 1–162 Author chain W8； PDBConstruct 1–162； UniProt 1–162 Author chain W9； PDBConstruct 1–162； UniProt 1–162 Author chain Y8； PDBConstruct 1–162； UniProt 1–162 Author chain Y9； PDBConstruct 1–162； UniProt 1–162 Author chain a8； PDBConstruct 1–162； UniProt 1–162 Author chain a9； PDBConstruct 1–162； UniProt 1–162 Author chain c9； PDBConstruct 1–162； UniProt 1–162 Author chain d8； PDBConstruct 1–162； UniProt 1–162 Author chain e9； PDBConstruct 1–162； UniProt 1–162 Author chain f8； PDBConstruct 1–162； UniProt 1–162 Author chain h8； PDBConstruct 1–162； UniProt 1–162 Author chain h9； PDBConstruct 1–162； UniProt 1–162 Author chain j9； PDBConstruct 1–162； UniProt 1–162 Author chain k8； PDBConstruct 1–162； UniProt 1–162 Author chain l9； PDBConstruct 1–162； UniProt 1–162 Author chain m8； PDBConstruct 1–162； UniProt 1–162 Author chain n9； PDBConstruct 1–162； UniProt 1–162 Author chain o8； PDBConstruct 1–162； UniProt 1–162 Author chain p9； PDBConstruct 1–162； UniProt 1–162 Author chain q8； PDBConstruct 1–162； UniProt 1–162 Author chain r9； PDBConstruct 1–162； UniProt 1–162 Author chain s8； PDBConstruct 1–162； UniProt 1–162 Author chain t9； PDBConstruct 1–162； UniProt 1–162 Author chain u8； PDBConstruct 1–162； UniProt 1–162 Author chain v9； PDBConstruct 1–162； UniProt 1–162 Author chain x9； PDBConstruct 1–162； UniProt 1–162 Author chain z9； PDBConstruct 1–162； UniProt 1–162

Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core

Nostoc sp. PCC 7120 = FACHB-418

UniProt P80558

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 288	Phycobilisome rod-core linker polypeptide CpcG2 × 2 （P29987） C-phycocyanin alpha subunit × 84 （P07121） C-phycocyanin beta subunit × 84 （P07120） Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod × 8 （P07123） Phycobilisome rod-core linker polypeptide CpcG4 × 4 （P29989） Phycobilisome rod-core linker polypeptide CpcG1 × 2 （P29986） Allophycocyanin subunit alpha 1 × 44 （P80555） Allophycocyanin subunit beta × 46 （P80557） Phycobiliprotein ApcE × 2 （P80559） Allophycocyanin subunit beta-18 × 2 （Q7A2D6） Allophycocyanin subunit alpha-B × 2 （P80556） PHYCOCYANOBILIN × 348	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PYC1_NOSS1
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain 29； PDBConstruct 1–68； UniProt 1–68 Author chain 39； PDBConstruct 1–68； UniProt 1–68 Author chain 49； PDBConstruct 1–68； UniProt 1–68 Author chain G8； PDBConstruct 1–68； UniProt 1–68 Author chain N8； PDBConstruct 1–68； UniProt 1–68 Author chain U8； PDBConstruct 1–68； UniProt 1–68 Author chain b8； PDBConstruct 1–68； UniProt 1–68 Author chain i8； PDBConstruct 1–68； UniProt 1–68

Phycobiliprotein ApcE

Nostoc sp. PCC 7120 = FACHB-418

UniProt P80559

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 288	Phycobilisome rod-core linker polypeptide CpcG2 × 2 （P29987） C-phycocyanin alpha subunit × 84 （P07121） C-phycocyanin beta subunit × 84 （P07120） Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod × 8 （P07123） Phycobilisome rod-core linker polypeptide CpcG4 × 4 （P29989） Phycobilisome rod-core linker polypeptide CpcG1 × 2 （P29986） Allophycocyanin subunit alpha 1 × 44 （P80555） Allophycocyanin subunit beta × 46 （P80557） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 8 （P80558） Allophycocyanin subunit beta-18 × 2 （Q7A2D6） Allophycocyanin subunit alpha-B × 2 （P80556） PHYCOCYANOBILIN × 348	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APCE_NOSS1
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain 09； PDBConstruct 1–1132； UniProt 1–1132 Author chain 19； PDBConstruct 1–1132； UniProt 1–1132

Allophycocyanin subunit beta-18

Nostoc sp. PCC 7120 = FACHB-418

UniProt Q7A2D6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 288	Phycobilisome rod-core linker polypeptide CpcG2 × 2 （P29987） C-phycocyanin alpha subunit × 84 （P07121） C-phycocyanin beta subunit × 84 （P07120） Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod × 8 （P07123） Phycobilisome rod-core linker polypeptide CpcG4 × 4 （P29989） Phycobilisome rod-core linker polypeptide CpcG1 × 2 （P29986） Allophycocyanin subunit alpha 1 × 44 （P80555） Allophycocyanin subunit beta × 46 （P80557） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 8 （P80558） Phycobiliprotein ApcE × 2 （P80559） Allophycocyanin subunit alpha-B × 2 （P80556） PHYCOCYANOBILIN × 348	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APCF_NOSS1
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain Q9； PDBConstruct 1–169； UniProt 1–169 Author chain g9； PDBConstruct 1–169； UniProt 1–169

Allophycocyanin subunit alpha-B

Nostoc sp. PCC 7120 = FACHB-418

UniProt P80556

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 288	Phycobilisome rod-core linker polypeptide CpcG2 × 2 （P29987） C-phycocyanin alpha subunit × 84 （P07121） C-phycocyanin beta subunit × 84 （P07120） Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod × 8 （P07123） Phycobilisome rod-core linker polypeptide CpcG4 × 4 （P29989） Phycobilisome rod-core linker polypeptide CpcG1 × 2 （P29986） Allophycocyanin subunit alpha 1 × 44 （P80555） Allophycocyanin subunit beta × 46 （P80557） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 8 （P80558） Phycobiliprotein ApcE × 2 （P80559） Allophycocyanin subunit beta-18 × 2 （Q7A2D6） PHYCOCYANOBILIN × 348	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APCD_NOSS1
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain V9； PDBConstruct 1–161； UniProt 1–161 Author chain m9； PDBConstruct 1–161； UniProt 1–161

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7eyd
Deposition date deposition_date	2021-05-30
Structure title title	Cryo-EM structure of cyanobacterial phycobilisome from Anabaena sp. PCC 7120
Keywords keywords	photosynthesis; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7eyd__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7eyd__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7eyd__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	152.10 Å
Total Rg	152.00 Å
Atom count	387586
Residues	49184
Excluded volume	6884600 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7eyd__assembly_1__model_1`	288-meric （288）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Description description	Phycobilisome rod-core linker polypeptide CpcG2
Molecular weight formula_weight	28688.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A1,A4
Atom count atom_count	387586

MSIPLLEYKPSSQNQRVPGYEVPNEDTPRIYRIEDAAYDSELKELIWATYRQVFSEHVILKFFRQGNLESQLKNRAISVRDFVRGLAKSEAFKTLVIKSNSNYRLVELALKRLLGRAPYNKDEEIAWSIKIATNGWDGFVDALLDSEEYQSNFGENIVPYQRRRYKDRPFNLVTPRYGNYWRDKLESERYIEGDIKNFLELAKSIEIKTVTFTPVSTANIKIPDTTRNTTPTGIPISVNPSANFPVR

Source Source

Source organism organism	Nostoc sp. PCC 7120 = FACHB-418
NCBI taxonomy ID ncbi_taxonomy_id	103690
Host organism host_organism	Nostoc sp. PCC 7120 = FACHB-418

Entity 2 Entity 2 polymer

Description description	C-phycocyanin alpha subunit
Molecular weight formula_weight	17475.5 kDa
Source method src_method	man
Copy count entity_count	84

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;B1,D1,F1,H1,J1,L1,O1,Q1,S1,U1,W1,Y1,B2,D2,F2,H2,J2,L2,O2,Q2,S2,U2,W2,Y2,B3,D3,F3,H3,J3,L3,B4,D4,F4,H4,J4,L4,O4,Q4,S4,U4,W4,Y4,B5,D5,F5,H5,J5,L5,O5,Q5,S5,U5,W5,Y5,B6,D6,F6,H6,J6,L6,O6,Q6,S6,U6,W6,Y6,B7,D7,F7,H7,J7,L7,BA,DA,FA,HA,JA,LA,OA,QA,SA,UA,WA,YA ;

MVKTPITEAIAAADTQGRFLGNTELQSARGRYERAAASLEAARGLTSNAQRLIDGATQAVYQKFPYTTQTPGPQFAADSRGKSKCARDVGHYLRIITYSLVAGGTGPLDEYLIAGLAEINSTFDLSPSWYVEALKHIKANHGLSGQAANEANTYIDYAINALS

Source Source

Source organism organism	Nostoc sp. PCC 7120 = FACHB-418
NCBI taxonomy ID ncbi_taxonomy_id	103690
Host organism host_organism	Nostoc sp. PCC 7120 = FACHB-418

Entity 3 Entity 3 polymer

Description description	C-phycocyanin beta subunit
Molecular weight formula_weight	18403.8 kDa
Source method src_method	man
Copy count entity_count	84

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;C1,E1,G1,I1,K1,M1,P1,R1,T1,V1,X1,Z1,C2,E2,G2,I2,K2,M2,P2,R2,T2,V2,X2,Z2,C3,E3,G3,I3,K3,M3,C4,E4,G4,I4,K4,M4,P4,R4,T4,V4,X4,Z4,C5,E5,G5,I5,K5,M5,P5,R5,T5,V5,X5,Z5,C6,E6,G6,I6,K6,M6,P6,R6,T6,V6,X6,Z6,C7,E7,G7,I7,K7,M7,CA,EA,GA,IA,KA,MA,PA,RA,TA,VA,XA,ZA ;

MTLDVFTKVVSQADSRGEFLSNEQLDALANVVKEGNKRLDVVNRITSNASAIVTNAARALFEEQPQLIAPGGNAYTNRRMAACLRDMEIILRYVTYAILAGDASVLDDRCLNGLRETYQALGTPGSSVAVGVQKMKDAAVGIANDPNGITKGDCSQLISEVASYFDRAAAAVG

Source Source

Source organism organism	Nostoc sp. PCC 7120 = FACHB-418
NCBI taxonomy ID ncbi_taxonomy_id	103690
Host organism host_organism	Nostoc sp. PCC 7120 = FACHB-418

Entity 4 Entity 4 polymer

Description description	Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod
Molecular weight formula_weight	32254.1 kDa
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N1,N2,N3,N4,N5,N6,N7,NA

MAITTAASRLGTEPFSDAPKVELRPKASREEVESVIRAVYRHVLGNDYILASERLVSAESLLRDGNLTVREFVRSVAKSELYKKKFFYNSFQTRLIELNYKHLLGRAPYDESEVVYHLDLYQNKGYDAEIDSYIDSWEYQSNFGDNVVPYYRGFETQVGQKTAGFNRIFRLYRGYANSDRAQVEGTKSRLARELASNKASTIVGPSGTNDSWGFRASADVAPKKNLGNAVGEGDRVYRLEVTGIRSPGYPSVRRSSTVFIVPYERLSDKIQQVHKQGGKIVSVTSA

Source Source

Source organism organism	Nostoc sp. PCC 7120 = FACHB-418
NCBI taxonomy ID ncbi_taxonomy_id	103690
Host organism host_organism	Nostoc sp. PCC 7120 = FACHB-418

Entity 5 Entity 5 polymer

Description description	Phycobilisome rod-core linker polypeptide CpcG4
Molecular weight formula_weight	29362.8 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A2,A5,A6,AA

MALPLLQYKPSSQNHRVTSFGAADQNEDTPYIYRIEDVSSYTDIQNIIWASYRQVFSEHEILKFNRQKTLESQVKNGSISVRDFIRGLAKSEAFYRLVVSVNNNYRLVDITLKRLLGRSSYNKDEQIAWSIVIGTKGFSGFVDALIDSEEYTKNFGENIVPYQRKRMEGRPHNLVTPRYGEDFQEKAGTVQTDWRFTLDKFYSRKSQEKQLREGDPRKFADLAASVGNQGNYAQRISAFDIDYLNAVPNRSRR

Source Source

Source organism organism	Nostoc sp. PCC 7120 = FACHB-418
NCBI taxonomy ID ncbi_taxonomy_id	103690
Host organism host_organism	Nostoc sp. PCC 7120 = FACHB-418

Entity 6 Entity 6 polymer

Description description	Phycobilisome rod-core linker polypeptide CpcG1
Molecular weight formula_weight	31973.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A3,A7

MSIPLLEYAPSSQNQRVEGYEVPNEDTPTIYRLAAAIDDADVDAIIWAGYRQIFSEHLIIKSNRQSFLESQLRNRAINVRDFIRGLGKSEVYRTQVADLNSNYRLVDITLKRFLGRAAYNQDEEIAWSIVIGSQGLHGFIDALLDSDEYRENFGDDIVPYQRRRYKDRPFNLVNPRYNAYWRDRQTLNALGGRSFYSARTSGTLTKDDIRRAIPANFMALAGKILTPERNYQRTIASVTSQIKDIKIPDTSREVTTPEVTVKPVAVALPYRYIPGNKTT

Source Source

Source organism organism	Nostoc sp. PCC 7120 = FACHB-418
NCBI taxonomy ID ncbi_taxonomy_id	103690
Host organism host_organism	Nostoc sp. PCC 7120 = FACHB-418

Entity 7 Entity 7 polymer

Description description	Allophycocyanin subunit alpha 1
Molecular weight formula_weight	17362.6 kDa
Source method src_method	man
Copy count entity_count	44

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A8,C8,E8,H8,J8,L8,O8,Q8,S8,V8,X8,Z8,c8,e8,g8,j8,l8,n8,p8,r8,t8,A9,C9,E9,G9,I9,K9,N9,P9,R9,T9,X9,Z9,b9,d9,f9,i9,k9,o9,q9,s9,u9,w9,y9

MSIVTKSIVNADAEARYLSPGELDRIKSFVAGGQQRLRIAQALTDNRERLVKQAGDQLFQKRPDVVSPGGNAYGQEMTATCLRDLDYYLRLVTYGIVAGDVTPIEEIGVIGVREMYKSLGTPIEAVGEGVRALKNAASTLLSAEDAAEAGSYFDYVVGALQ

Source Source

Source organism organism	Nostoc sp. PCC 7120 = FACHB-418
NCBI taxonomy ID ncbi_taxonomy_id	103690
Host organism host_organism	Nostoc sp. PCC 7120 = FACHB-418

Entity 8 Entity 8 polymer

Description description	Allophycocyanin subunit beta
Molecular weight formula_weight	17320.7 kDa
Source method src_method	man
Copy count entity_count	46

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;B8,D8,F8,I8,K8,M8,P8,R8,T8,W8,Y8,a8,d8,f8,h8,k8,m8,o8,q8,s8,u8,B9,D9,F9,H9,J9,L9,M9,O9,S9,U9,W9,Y9,a9,c9,e9,h9,j9,l9,n9,p9,r9,t9,v9,x9,z9 ;

MAQDAITAVINSADVQGKYLDTAALEKLKAYFSTGELRVRAATTISANAAAIVKEAVAKSLLYSDITRPGGNMYTTRRYAACIRDLDYYLRYATYAMLAGDPSILDERVLNGLKETYNSLGVPVGATVQAIQAIKEVTASLVGADAGKEMGIYLDYISSGLS

Source Source

Source organism organism	Nostoc sp. PCC 7120 = FACHB-418
NCBI taxonomy ID ncbi_taxonomy_id	103690
Host organism host_organism	Nostoc sp. PCC 7120 = FACHB-418

Entity 9 Entity 9 polymer

Description description	Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core
Molecular weight formula_weight	7852.1 kDa
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G8,N8,U8,b8,i8,29,39,49

MSRLFKITALVPSLSRTRTQRELQNTYFTKLVPYENWFREQQRIQKAGGKIIKVELATGKQGTNAGLQ

Source Source

Source organism organism	Nostoc sp. PCC 7120 = FACHB-418
NCBI taxonomy ID ncbi_taxonomy_id	103690
Host organism host_organism	Nostoc sp. PCC 7120 = FACHB-418

Entity 10 Entity 10 polymer

Description description	Phycobiliprotein ApcE
Molecular weight formula_weight	127045.8 kDa
EC 编号 ec_number	4.-.-.-
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	09,19

MSVKASGGSSVARPQLYQTLAVATITQAEQQDRFLGRGELDELASYFASGAKRLEIAQLLTENSEIIVSRAANRIFVGGSPMAFLEKPREPELAMAAVGGGGDVRESMKLGTVTYVETRGGFLENLRSIFNTSPSGPTPPGFRPINIARYGPSNMAKSLRDLSWFLRYATYAIVAGDPNIIVVNTRGLREIIENACSGEATIVALQEIKAASLSYFRKDPEAAEIVSQYMDVLITEFKAPTPSNKLRQRPSGDQQGLQLPQIYFSAAERRPKFVMKTGLSATEKNEVIKAAYRQIFERDITRAYSLSISDLESKVKNGDISMKEFVRRLAKSPLYQKQFYQPFINSRVIELAFRHILGRGPSSREEVQKYFSIISNGGLPALVDALVDSAEYSDYFGEETVPYLRGLGQEAQECRNWGPQQDLFNYSAPFRKVPQFITTFAAYDRPLPDQHPYGSGNDPLEIQFGAIFPKETRNPSTSPAPFGKDTRRILIHQGPGINNQVSNPSARGLAPGSLGPKVFKLDQLPGTIGKKAAKGASVKFSESSTQAVIKATYLQVFGRDVYEGQRLKVQEIKLENGEISVRDFVRALAKSDLFRKLYWTPFYVCKAIEYIHRRLLGRPTYGRQENNKYFDIASKKGLYAVVDAILDSLEYTETFGEDTVPYERYLTPAGVALRQLRVGTIREDVANVEKQETPRFVELGTVKENRTQPDIDFRINQGVTKQREQTKVFKRVAGIKDKAAIKTLISAAYRQIFERDIAPYIAQNEFSGWESKLGNGEITVKEFIEGLGYSNLYLKEFYTPYPNTKVIELGTKHFLGRAPIDQAEIRKYNQILATQGIRAFINALVNSQEYNEVFGEDTVPYRRFPTLPAANFPNTQKLYNQLTKQNNDVVIPSFKPVQARIQSDKTPILAKAIADLAAQAKQMDKSKPLFIELGRSYNDGRGQSVEVGVGTTRRKPARIYRLTNGIGQAEKQLVINAIYRQVLDVFSGQVPDYYRRTELDSKLRNGEISVREFVREIASSEIYRKRFYTPYPNTKVIEFLFRHLLGRAPATQGEIRQYNKLLADNGLRAAVEAIVDSPEYSRYFGEDVVPYPRFPSLPAGNYLGSVQAAADLVKQSWSSLSPSTLTGRPGDR

Source Source

Source organism organism	Nostoc sp. PCC 7120 = FACHB-418
NCBI taxonomy ID ncbi_taxonomy_id	103690
Host organism host_organism	Nostoc sp. PCC 7120 = FACHB-418

Entity 11 Entity 11 polymer

Description description	Allophycocyanin subunit beta-18
Molecular weight formula_weight	18657.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q9,g9

MRDAVTSLIKNYDVAGRYFDRNAIDTLKDYFDSGTARVQAAAAINSNAAALVKQAGSKLFEELPELIRPGGNAYTTRRLAACLRDMDYYLRYATYALVAGNTNVLDERVLQGLRETYNSLGVPIGPTVRGVQILKDLVKEQVAGAGIANTTFVEEPFDHITRELSERDV

Source Source

Source organism organism	Nostoc sp. PCC 7120 = FACHB-418
NCBI taxonomy ID ncbi_taxonomy_id	103690
Host organism host_organism	Nostoc sp. PCC 7120 = FACHB-418

Entity 12 Entity 12 polymer

Description description	Allophycocyanin subunit alpha-B
Molecular weight formula_weight	17828.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V9,m9

MTVISQVILQADDELRYPSSGELKSISDFLQTGVQRTRIVATLAENEKKIVQEATKQLWQKRPDFIAPGGNAYGERQRALCIRDFGWYLRLITYGVLAGDIEPIEKIGIIGVREMYNSLGVPVPGMVEAINSLKKASLDLLSSEDAAAAAPYFDYIIQAMS

Source Source

Source organism organism	Nostoc sp. PCC 7120 = FACHB-418
NCBI taxonomy ID ncbi_taxonomy_id	103690
Host organism host_organism	Nostoc sp. PCC 7120 = FACHB-418

Entity 13 Entity 13 non-polymer

Description description	PHYCOCYANOBILIN
Molecular weight formula_weight	588.7 kDa
Source method src_method	syn
Copy count entity_count	348

▶

Resolution resolution	3.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	62439

Cryo-EM structure of cyanobacterial phycobilisome from Anabaena sp. PCC 7120

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phycobilisome rod-core linker polypeptide CpcG2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

C-phycocyanin alpha subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

C-phycocyanin beta subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobilisome rod-core linker polypeptide CpcG4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobilisome rod-core linker polypeptide CpcG1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Allophycocyanin subunit alpha 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Allophycocyanin subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobiliprotein ApcE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer