SAXSdb — 9w7k

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I-associated linker protein CpcL

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod × 2 （P07123） C-phycocyanin alpha subunit × 12 （P07121） C-phycocyanin beta subunit × 12 （P07120） PHYCOCYANOBILIN × 36	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CPCL_NOSS1
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 1； PDBConstruct 1–191； UniProt 2–192

Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod

OrganismNot specified

UniProt P07123

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	Photosystem I-associated linker protein CpcL × 1 （P29988） C-phycocyanin alpha subunit × 12 （P07121） C-phycocyanin beta subunit × 12 （P07120） PHYCOCYANOBILIN × 36	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PYR1_NOSS1
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 2； PDBConstruct 1–285； UniProt 2–286 Author chain 3； PDBConstruct 1–285； UniProt 2–286

C-phycocyanin alpha subunit

OrganismNot specified

UniProt P07121

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	Photosystem I-associated linker protein CpcL × 1 （P29988） Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod × 2 （P07123） C-phycocyanin beta subunit × 12 （P07120） PHYCOCYANOBILIN × 36	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHCA_NOSS1
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain B； PDBConstruct 1–162； UniProt 2–163 Author chain D； PDBConstruct 1–162； UniProt 2–163 Author chain F； PDBConstruct 1–162； UniProt 2–163 Author chain H； PDBConstruct 1–162； UniProt 2–163 Author chain J； PDBConstruct 1–162； UniProt 2–163 Author chain L； PDBConstruct 1–162； UniProt 2–163 Author chain O； PDBConstruct 1–162； UniProt 2–163 Author chain Q； PDBConstruct 1–162； UniProt 2–163 Author chain S； PDBConstruct 1–162； UniProt 2–163 Author chain U； PDBConstruct 1–162； UniProt 2–163 Author chain W； PDBConstruct 1–162； UniProt 2–163 Author chain Y； PDBConstruct 1–162； UniProt 2–163

C-phycocyanin beta subunit

OrganismNot specified

UniProt P07120

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	Photosystem I-associated linker protein CpcL × 1 （P29988） Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod × 2 （P07123） C-phycocyanin alpha subunit × 12 （P07121） PHYCOCYANOBILIN × 36	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHCB_NOSS1
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain C； PDBConstruct 1–172； UniProt 2–173 Author chain E； PDBConstruct 1–172； UniProt 2–173 Author chain G； PDBConstruct 1–172； UniProt 2–173 Author chain I； PDBConstruct 1–172； UniProt 2–173 Author chain K； PDBConstruct 1–172； UniProt 2–173 Author chain M； PDBConstruct 1–172； UniProt 2–173 Author chain P； PDBConstruct 1–172； UniProt 2–173 Author chain R； PDBConstruct 1–172； UniProt 2–173 Author chain T； PDBConstruct 1–172； UniProt 2–173 Author chain V； PDBConstruct 1–172； UniProt 2–173 Author chain X； PDBConstruct 1–172； UniProt 2–173 Author chain Z； PDBConstruct 1–172； UniProt 2–173

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9w7k
Deposition date deposition_date	2025-08-06
Structure title title	Cryo-EM structure of CpcL-PBS2
Keywords keywords	Phycobilisomes, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9w7k__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9w7k__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9w7k__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	48.82 Å
Rg (electron density)	47.94 Å
Total Rg	48.25 Å
Atom count	35862
Residues	4543
Excluded volume	634820 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9w7k__assembly_1__model_1`	27-meric （27）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Photosystem I-associated linker protein CpcL
Molecular weight formula_weight	22267.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1
Atom count atom_count	35862

ALPLLEYKPTTQNQRVQSFGTADVNEDTPYIYRLENANSPSEIEELIWAAYRQVFNEQEILKFNRQIGLETQLKNRSITVKDFIRGLAKSERFYQLVVTPNNNYRLVEMSLKRLLGRSPYNEEEKIAWSIQIASKGWGGFVDALIDSTEYEQAFGDNTVPYQRKRLTTDRPFSFTPRYGADYRDRAGIVRP

Entity 2 Entity 2 polymer

Description description	Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod
Molecular weight formula_weight	32122.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2,3

AITTAASRLGTEPFSDAPKVELRPKASREEVESVIRAVYRHVLGNDYILASERLVSAESLLRDGNLTVREFVRSVAKSELYKKKFFYNSFQTRLIELNYKHLLGRAPYDESEVVYHLDLYQNKGYDAEIDSYIDSWEYQSNFGDNVVPYYRGFETQVGQKTAGFNRIFRLYRGYANSDRAQVEGTKSRLARELASNKASTIVGPSGTNDSWGFRASADVAPKKNLGNAVGEGDRVYRLEVTGIRSPGYPSVRRSSTVFIVPYERLSDKIQQVHKQGGKIVSVTSA

Entity 3 Entity 3 polymer

Description description	C-phycocyanin alpha subunit
Molecular weight formula_weight	17344.3 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H,J,L,O,Q,S,U,W,Y

VKTPITEAIAAADTQGRFLGNTELQSARGRYERAAASLEAARGLTSNAQRLIDGATQAVYQKFPYTTQTPGPQFAADSRGKSKCARDVGHYLRIITYSLVAGGTGPLDEYLIAGLAEINSTFDLSPSWYVEALKHIKANHGLSGQAANEANTYIDYAINALS

Entity 4 Entity 4 polymer

Description description	C-phycocyanin beta subunit
Molecular weight formula_weight	18272.6 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,E,G,I,K,M,P,R,T,V,X,Z

TLDVFTKVVSQADSRGEFLSNEQLDALANVVKEGNKRLDVVNRITSNASAIVTNAARALFEEQPQLIAPGGNAYTNRRMAACLRDMEIILRYVTYAILAGDASVLDDRCLNGLRETYQALGTPGSSVAVGVQKMKDAAVGIANDPNGITKGDCSQLISEVASYFDRAAAAVG

Entity 5 Entity 5 non-polymer

Description description	PHYCOCYANOBILIN
Molecular weight formula_weight	588.7 kDa
Source method src_method	syn
Copy count entity_count	36

▶

Resolution resolution	2.58 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	270378

Cryo-EM structure of CpcL-PBS2

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I-associated linker protein CpcL

State in the Current Structure

Other States of the Same Protein in the Database

Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod

State in the Current Structure

Other States of the Same Protein in the Database

C-phycocyanin alpha subunit

State in the Current Structure

Other States of the Same Protein in the Database

C-phycocyanin beta subunit

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9w7k__assembly_1__model_1

9w7k__assembly_1__model_1 | I(q)

9w7k__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 non-polymer

7. Citations (1)

Cryo-EM structure of CpcL-PBS2

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I-associated linker protein CpcL

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

C-phycocyanin alpha subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

C-phycocyanin beta subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9w7k__assembly_1__model_1

9w7k__assembly_1__model_1 | I(q)

9w7k__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 non-polymer

7. Citations (1)