SAXSdb — 7f4t

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

MT-a70 family protein

Tetrahymena thermophila SB210

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Ptep2 × 1 （A0DWP1） S-ADENOSYLMETHIONINE × 1 water × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Ptep2 × 1 （A0DWP1） S-ADENOSYLMETHIONINE × 1 water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Ptep2 × 1 （A0DWP1） S-ADENOSYLMETHIONINE × 1 water × 1	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Ptep2 × 1 （A0DWP1） S-ADENOSYLMETHIONINE × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q22GC0_TETTS
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–247； UniProt 182–428 Author chain E； PDBConstruct 1–247； UniProt 182–428 Author chain H； PDBConstruct 1–247； UniProt 182–428 Author chain K； PDBConstruct 1–247； UniProt 182–428

Ptep2

Paramecium tetraurelia strain d4-2

UniProt A0DWP1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	MT-a70 family protein × 1 （Q22GC0） S-ADENOSYLMETHIONINE × 1 water × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	MT-a70 family protein × 1 （Q22GC0） S-ADENOSYLMETHIONINE × 1 water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	MT-a70 family protein × 1 （Q22GC0） S-ADENOSYLMETHIONINE × 1 water × 1	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	MT-a70 family protein × 1 （Q22GC0） S-ADENOSYLMETHIONINE × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0DWP1_PARTE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–128； UniProt 1–128 Author chain D； PDBConstruct 1–128； UniProt 1–128 Author chain G； PDBConstruct 1–128； UniProt 1–128 Author chain J； PDBConstruct 1–128； UniProt 1–128

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7f4t
Deposition date deposition_date	2021-06-21
Structure title title	Crystal structure of SAM-bound TthMTA1-Ptep2 complex
Keywords keywords	Protein Complex, DNA BINDING PROTEIN; DNA BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7f4t__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7f4t__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7f4t__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	25.48 Å
Rg (electron density)	25.05 Å
Total Rg	25.86 Å
Atom count	2738
Residues	343
Excluded volume	48765 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7f4t__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`7f4t__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`7f4t__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`7f4t__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	MT-a70 family protein
Molecular weight formula_weight	28481.6 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,E,H,K
Atom count atom_count	10725

DDYLDRLPKSKKGLQGLLQDIEKRILHYKQLFFKEQNEIANGKRSMVPDNSIPICSDVTKLNFQALIDAQMRHAGKMFDVIMMDPPWQLSSSQPSRGVAIAYDSLSDEKIQNMPIQSLQQDGFIFVWAINAKYRVTIKMIENWGYKLVDEITWVKKTVNGKIAKGHGFYLQHAKESCLIGVKGDVDNGRFKKNIASDVIFSERRGQSQKPEEIYQYINQLCPNGNYLEIFARRNNLHDNWVSIGNEL

Source Source

Source organism organism	Tetrahymena thermophila SB210
NCBI taxonomy ID ncbi_taxonomy_id	312017
Host organism host_organism	Escherichia coli K-12

Entity 2 Entity 2 polymer

Description description	Ptep2
Molecular weight formula_weight	15096.5 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,G,J

MSTISREEYAKKMRLALSDNHICKPDGTVNHQYFLVKKGQYWGEEKIQYLIEQLEKIGVGNWKQMQKGLLEQTSEIELELRTCLLFKTTDIQPYMDKKFTKIEIEQIAQQNIEKAQQLSKLKYGVFVV

Source Source

Source organism organism	Paramecium tetraurelia strain d4-2
NCBI taxonomy ID ncbi_taxonomy_id	412030
Host organism host_organism	Escherichia coli K-12

Entity 3 Entity 3 non-polymer

Description description	S-ADENOSYLMETHIONINE
Molecular weight formula_weight	398.4 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	12

▶

Unit-cell length a length_a	98.130 Å
Unit-cell length b length_b	110.193 Å
Unit-cell length c length_c	102.636 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	91.64 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	monoclinic

Resolution resolution	3.680 Å
Low-resolution limit resolution_low	49.040 Å
R factor r_factor	0.2857
R_work r_work	0.2835
R_free r_free	0.3288

Crystal structure of SAM-bound TthMTA1-Ptep2 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

MT-a70 family protein

State in the Current Structure

Other States of the Same Protein in the Database

Ptep2

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7f4t__assembly_1__model_1

7f4t__assembly_1__model_1 | I(q)

7f4t__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)

Crystal structure of SAM-bound TthMTA1-Ptep2 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

MT-a70 family protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ptep2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7f4t__assembly_1__model_1

7f4t__assembly_1__model_1 | I(q)

7f4t__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)