7hlk

PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z285642082

Method: X-RAY DIFFRACTION D_max: 53.3 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

E3 ubiquitin-protein ligase TRIM21

Mus musculus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain B； UniProt 291–470	Not recorded	EDO 1,2-ETHANEDIOL × 2 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 SO4 SULFATE ION × 1 UUP N-cyclopropylpyrazolo[1,5-a]pyrimidine-3-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.39 Å R-free 0.212

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7HLK	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2VOK Murine TRIM21 Deposited 2008-02-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 291–470（180 aa） Chain B 291–470（180 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.30 Å R-free 0.236
3ZO0 Mouse IgG2a in complex with mouse TRIM21 PRYSPRY Deposited 2013-02-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 291–470（180 aa） Fragment：RESIDUES 291-470	Not recorded	MAN alpha-D-mannopyranose × 2 FUC alpha-L-fucopyranose × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.99 Å R-free 0.253
7HLA PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z111634612 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 A1BE6 (8R)-2-methyl-5-(propan-2-yl)[1,2,4]triazolo[1,5-a]pyrimidin-7(4H)-one × 2 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.23 Å R-free 0.190
7HLB PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z45705015 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	S9S ~{N}-[2-(4-fluorophenyl)ethyl]methanesulfonamide × 1 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.21 Å R-free 0.197
7HLC PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1079512010 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 UWS 6-methyl-2-[(3-methyl-1,2-oxazol-5-yl)methyl]pyridazin-3(2H)-one × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.35 Å R-free 0.206
7HLD PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1401276297 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 U0S (5S)-7-(pyrazin-2-yl)-2-oxa-7-azaspiro[4.4]nonane × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.22 Å R-free 0.196
7HLE PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1696844792 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	UXG 1-(diphenylmethyl)azetidin-3-ol × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.40 Å R-free 0.209
7HLF PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z2092555279 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 SO4 SULFATE ION × 1 A1BE7 (3R)-3-ethyl-1-(5-fluoropyridin-2-yl)pyrrolidin-3-ol × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.39 Å R-free 0.204
7HLG PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z2365130785 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 SO4 SULFATE ION × 1 A1BE8 (1r,3r)-3-[(3-fluoropyridin-2-yl)amino]-1-methylcyclobutan-1-ol × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.50 Å R-free 0.208
7HLH PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z453319206 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 SO4 SULFATE ION × 1 LWD ~{N}-quinolin-6-ylbenzamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.38 Å R-free 0.195
7HLI PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z2017861827 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	A1BE9 1-[(1S,4S)-1,2,3,4-tetrahydro-1,4-(epiminomethano)naphthalen-10-yl]ethan-1-one × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.35 Å R-free 0.211
7HLJ PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1980894300 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 TU6 [4-methyl-6-(piperidin-1-yl)pyrimidin-2-yl]methanol × 1 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.37 Å R-free 0.198
7HLL PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1328968520 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 J4Q 4-[(2-methylsulfonylimidazol-1-yl)methyl]-1,3-thiazole × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.15 Å R-free 0.188
7HLM PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z29077827 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	GTJ ~{N}-(1-propylbenzimidazol-2-yl)propanamide × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.15 Å R-free 0.192
7HLN PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z26823525 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	A1A4A (2S)-N-(5-ethyl-1,3,4-thiadiazol-2-yl)oxolane-2-carboxamide × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.20 Å R-free 0.194
7HLO PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z90122368 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 SO4 SULFATE ION × 1 A1BFA 4-acetylpiperazine-1-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.15 Å R-free 0.190
7HLP PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z29634868 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 SO4 SULFATE ION × 1 A1BFB 2-oxo-4-propyl-2H-1-benzopyran-7-yl acetate × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.19 Å R-free 0.198
7HLQ PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z32327641 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 JMM [4-(cyclopropanecarbonyl)piperazin-1-yl](furan-2-yl)methanone × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.33 Å R-free 0.200
7HLR PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1430613393 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 LKU 3-fluoro-N-(3-hydroxy-4-methylphenyl)benzamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.34 Å R-free 0.200
7HLS PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z29177127 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 A1BFC 3-(2-methylpropanamido)benzamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.15 Å R-free 0.195
7HLT PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z328695024 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 3 K1G N,1-dimethyl-N-(propan-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine × 2 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.15 Å R-free 0.187
7HLU PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z741055844 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	S0V morpholin-4-yl(1,2,3-thiadiazol-4-yl)methanone × 2 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.15 Å R-free 0.187
7HLV PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z79432418 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 A1BFD 2-(2-oxopyrrolidin-1-yl)-N-(1,3-thiazol-2-yl)acetamide × 2 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.19 Å R-free 0.197
7HLW PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z438096750 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	A1BFF N-{[(3S)-1-acetylpiperidin-3-yl]methyl}methanesulfonamide × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.40 Å R-free 0.216
7HLX PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z32367954 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 UXA ~{N}-cyclopropyl-1,3-benzodioxole-5-carboxamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.28 Å R-free 0.195
7HLY PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z235449082 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 JFS [4-(1H-benzimidazol-1-yl)phenyl]methanol × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.32 Å R-free 0.199
7HLZ PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z256709358 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 BP4 biphenyl-4-ylacetic acid × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.29 Å R-free 0.195
7HM0 PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z374427992 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	A1BFG N-{[2-(dimethylamino)pyridin-4-yl]methyl}acetamide × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.43 Å R-free 0.214
7HM1 PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z793778804 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	VWV ethyl (1,1-dioxo-1lambda~6~,4-thiazinan-4-yl)acetate × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.34 Å R-free 0.212
7HM2 PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z32400357 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	NZJ 1-(3-methylbenzene-1-carbonyl)piperidine-4-carboxamide × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.15 Å R-free 0.200
7HM3 PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1359419878 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 3 K6U (2M)-2-(2-methoxyphenyl)-1,3,4-oxadiazole × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.23 Å R-free 0.198
7HM4 PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1407673036 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	VW4 (2S)-2-phenylpropane-1-sulfonamide × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.42 Å R-free 0.213
7HM5 PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z192955056 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 Q4L methyl 4-(4-fluorophenyl)piperazine-1-carboxylate × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.38 Å R-free 0.202
7HM6 PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1172243962 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 A1BDJ 5-fluoro-N-(oxan-4-yl)pyridin-2-amine × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.33 Å R-free 0.197
7HM7 PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1635496816 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 A1BFH N-(6-methyl-2H-1,3-benzodioxol-5-yl)acetamide × 1 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.34 Å R-free 0.193
7HM8 PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z285782452 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 UVA N-methyl-2-(methylsulfonyl)aniline × 1 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.33 Å R-free 0.199
7HM9 PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1222331430 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	A1BFI N,N-dimethyl-1,2,3,4-tetrahydroquinoline-6-carboxamide × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.25 Å R-free 0.200
7HMA PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z291279160 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 LV4 1-[2-(trifluoromethyloxy)phenyl]thiourea × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.15 Å R-free 0.189
7HMB PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1374778753 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	B1J [1-(4-chlorophenyl)-1,2,3-triazol-4-yl]methanol × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.36 Å R-free 0.207
7HMC PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1954800564 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 NZ1 5-methoxy-1,3-benzothiazol-2-amine × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.32 Å R-free 0.205
7HMD PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z425387594 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 3 H04 1-(2-ethoxyphenyl)piperazine × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.29 Å R-free 0.191
7HME PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z319545618 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 RXS 3-[(2-methyl-1H-imidazol-1-yl)methyl]benzonitrile × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.51 Å R-free 0.204
7HMF PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1367324110 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 RZJ 1-methyl-3,4-dihydro-2~{H}-quinoline-7-sulfonamide × 2 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.20 Å R-free 0.195
7HMG PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z274575916 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 3 WKS 2,4-dimethyl-6-(piperazin-1-yl)pyrimidine × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.32 Å R-free 0.184
7HMH PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1636723439 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 A1BFJ (2R)-N-methylmorpholine-2-carboxamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.50 Å R-free 0.213
7HMI PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1742054999 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	A1BFK N,N-dimethyl-5-(piperidin-4-yl)-1,2,4-oxadiazol-3-amine × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.42 Å R-free 0.215
7HMJ PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1578665941 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	K1P 1-(3-methyl-1,2,4-thiadiazol-5-yl)-1,4-diazepane × 1 EDO 1,2-ETHANEDIOL × 2 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.50 Å R-free 0.214
7HMK PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z271004858 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 SFY 4-amino-N-(pyridin-2-yl)benzenesulfonamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.35 Å R-free 0.209
7HML PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1354416068 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	X1J 1-(5-amino-1,3-dihydro-2H-isoindol-2-yl)ethan-1-one × 1 EDO 1,2-ETHANEDIOL × 2 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.26 Å R-free 0.201
7HMM PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z165170770 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	W0Y N-methyl-4-sulfamoylbenzamide × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.28 Å R-free 0.199
7HMN PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z57478994 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 UVS 5-(methoxymethyl)-1,3,4-thiadiazol-2-amine × 1 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.33 Å R-free 0.202
7HMO PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z198194394 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 O1M 4-(4-fluorophenyl)piperazine-1-carboxamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.30 Å R-free 0.201
7HMP PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1530301542 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 ZQA 4-ethyl-2-(1H-imidazol-5-yl)-1,3-thiazole × 2 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.15 Å R-free 0.192
7HMQ PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1267773633 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	A1A36 1-(2-ethyl-1,3-thiazol-5-yl)-N-methylmethanamine × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.43 Å R-free 0.203
7HMR PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1267882044 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	A1BFL N-{[(2R)-oxolan-2-yl]methyl}pyridin-4-amine × 1 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.15 Å R-free 0.192
7HMS PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z126932614 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	T6J 2-[(methylsulfonyl)methyl]-1H-benzimidazole × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.15 Å R-free 0.194
7HMT PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z2004563941 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	A1BFM (1R)-1-(1-cyclopentyl-1H-pyrazol-4-yl)ethan-1-ol × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.28 Å R-free 0.206
7HMU PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1741966151 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	W1A N-[(piperidin-4-yl)methyl]methanesulfonamide × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.15 Å R-free 0.189
7HMV PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z56978034 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	U2R (4-fluorophenoxy)acetic acid × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.15 Å R-free 0.194
7HMW PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1492796719 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	S7G ~{N}-[(3~{R})-1,2,3,4-tetrahydroquinolin-3-yl]ethanamide × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.34 Å R-free 0.207
7HMX PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z763030030 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 WJA N-methyl-1-(5-methyl-1,2-oxazol-3-yl)methanesulfonamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.57 Å R-free 0.239
7HMY PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z111782404 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 ZTQ (2S)-2-[([1,1'-biphenyl]-4-yl)oxy]propanoic acid × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.15 Å R-free 0.188
7HMZ PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z85893853 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 A1BFN (3S)-1-[(4-fluorophenyl)acetyl]piperidine-3-carboxylic acid × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.28 Å R-free 0.199
7HN0 PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1217960891 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	Q49 (3S)-3-(3-fluorophenoxy)-1-methylpyrrolidin-2-one × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.33 Å R-free 0.204
7HN1 PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z2065616520 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 A1BFO N-ethyl-1-(pyridin-4-yl)piperidin-4-amine × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.47 Å R-free 0.229
7HN2 PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1002247062 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 A1BFP N-{[(2R)-4-methylmorpholin-2-yl]methyl}-1,3-thiazol-2-amine × 1 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.23 Å R-free 0.198
7HN3 PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z2301438417 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 A1BFQ 1,3-dimethyl-1H-pyrazolo[3,4-d]pyridazin-7-ol × 1 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.28 Å R-free 0.198
7HN4 PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z56827661 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 VZY N-(3-methylbenzene-1-carbonyl)glycine × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.19 Å R-free 0.195
7HN5 PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z45617795 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	JFM N-(2-phenylethyl)methanesulfonamide × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.32 Å R-free 0.194
7HN6 PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1998104358 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	A1BFR (5S)-N,N-dimethyl-2,9-dioxa-6-azaspiro[4.5]decane-6-carboxamide × 1 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.40 Å R-free 0.212
7HN7 PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z198194396 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 K2M 4-(furan-2-carbonyl)piperazine-1-carboxamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.31 Å R-free 0.203
7HN8 PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1318110042 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	A1BFS 4-[(but-2-yn-1-yl)(methyl)amino]-1lambda~6~-thiane-1,1-dione × 2 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.23 Å R-free 0.197
7HN9 PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1787761777 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	A1BFT (3S,4S)-3-methoxy-4-methyl-1-[(1,3-thiazol-5-yl)methyl]piperidine × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.22 Å R-free 0.195
7HNA PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1929757385 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 WGM (3S)-1-(3-fluoropyridin-2-yl)-4,4-dimethylpyrrolidin-3-ol × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.29 Å R-free 0.196
7HNB PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z31478538 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	T9Q N-Benzyl-2-methoxyacetamide × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.52 Å R-free 0.208
7HNC PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z220996120 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	TV9 N-[(1S)-1-(pyridin-3-yl)ethyl]cyclopropanecarboxamide × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.15 Å R-free 0.203
7HND PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z52314092 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	U78 ~{N}-[2-(2-methylphenyl)ethyl]ethanamide × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.34 Å R-free 0.204
7HNE PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1343518214 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	A1BFU 1-(3-methoxyazetidine-1-sulfonyl)pyrrolidine × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.33 Å R-free 0.198
7HNF PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1689442171 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	A1BFV (5-fluoro-3,6-dihydropyridin-1(2H)-yl)(morpholin-4-yl)methanone × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.32 Å R-free 0.202
7HNG PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1568344634 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	O3D 4-[(furan-2-yl)methyl]-1lambda~6~,4-thiazinane-1,1-dione × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.34 Å R-free 0.202
7HNH PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z2643472210 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 A1BFW 1-methyl-N-{[(2S)-oxolan-2-yl]methyl}-1H-pyrazole-3-carboxamide × 1 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.34 Å R-free 0.194
7HNI PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z373768900 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 NUA N-(1-ethyl-1H-pyrazol-4-yl)cyclobutanecarboxamide × 1 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.27 Å R-free 0.190
7HNJ PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1162778919 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	A1AP3 1-[(5-ethyl-1,2,4-oxadiazol-3-yl)methyl]pyridin-2(1H)-one × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.43 Å R-free 0.196
7HNK PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1275599911 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	WKG 1-(2-azaspiro[5.6]dodecan-2-yl)ethan-1-one × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.39 Å R-free 0.205
7HNL PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1251207602 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 RWS 1-(5-methyl-1,3,4-thiadiazol-2-yl)piperidine × 1 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.44 Å R-free 0.216
7HNM PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z768399682 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	A1BFX [(2R,5S)-2,5-dimethylmorpholin-4-yl](1,2,5-thiadiazol-3-yl)methanone × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.49 Å R-free 0.209
7HNN PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z31432226 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	JGP (azepan-1-yl)(2H-1,3-benzodioxol-5-yl)methanone × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.31 Å R-free 0.202
7HNO PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z57450788 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 3 RV4 N-{4-[(morpholin-4-yl)methyl]phenyl}acetamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.33 Å R-free 0.189
7HNP PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z106579662 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 NUY [4-(propan-2-yl)piperazin-1-yl](thiophen-2-yl)methanone × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.30 Å R-free 0.199
7HNQ PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z30620520 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 GX4 cyclopropyl-[4-(4-fluorophenyl)piperazin-1-yl]methanone × 1 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.37 Å R-free 0.196
7HNR PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1545312521 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	NTV (2S)-N-(3-chloro-2-methylphenyl)oxolane-2-carboxamide × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.30 Å R-free 0.202
7HNS PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z2072621991 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 LQP 2-(difluoromethoxy)-1-[(3aR,6aS)-hexahydrocyclopenta[c]pyrrol-2(1H)-yl]ethan-1-one × 1 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.29 Å R-free 0.201
7HNT PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z383202616 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 LHR N-(1H-indazol-6-yl)acetamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.17 Å R-free 0.197
7HNU PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1614545742 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 GQJ methyl (2~{S},4~{R})-1-(furan-2-ylcarbonyl)-4-oxidanyl-pyrrolidine-2-carboxylate × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.15 Å R-free 0.202
7HNV PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z404993336 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 UUM 5-methyl-N-(1-methyl-1H-pyrazol-4-yl)-1,2-oxazole-3-carboxamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.34 Å R-free 0.191
7HNW PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1446981563 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	A1BFY N-[(9S)-6-oxaspiro[4.5]decan-9-yl]methanesulfonamide × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.21 Å R-free 0.191
7HNX PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z133729708 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	WHP N-[(1R)-1-(2-chlorophenyl)ethyl]methanesulfonamide × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.27 Å R-free 0.196
7HNY PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z44592329 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 K0G N-phenyl-N'-pyridin-3-ylurea × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.28 Å R-free 0.193
7HNZ PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1245793018 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 JGD N,N-dimethylpyridin-4-amine × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.15 Å R-free 0.189
7HO0 PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z363071686 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	A1A3S N-methyl-N-[2-oxo-2-(piperidin-1-yl)ethyl]methanesulfonamide × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.15 Å R-free 0.196
7HO1 PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z369263636 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 A1BFZ N-[(1R)-1-(1,5-dimethyl-1H-pyrazol-4-yl)ethyl]methanesulfonamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.17 Å R-free 0.193
7HO2 PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z730649594 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 NUM N-[2-(4-hydroxyphenyl)ethyl]pyridine-2-carboxamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.15 Å R-free 0.192
7HO3 PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z405825414 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	A1BF0 N-[(3S)-1-propanoylpiperidin-3-yl]methanesulfonamide × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.45 Å R-free 0.185
7HO4 PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1003146540 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 LL0 2-(difluoromethoxy)benzene-1-sulfonamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.21 Å R-free 0.194
7HO5 PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1266933824 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 UXD (1H-pyrazol-4-yl)(pyrrolidin-1-yl)methanone × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.18 Å R-free 0.196
7HO6 PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z3220108246 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	A1BF1 4-benzylpiperazine-2,6-dione × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.24 Å R-free 0.192
7HO7 PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z30820160 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 JFP N-(4-methyl-1,3-thiazol-2-yl)propanamide × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.30 Å R-free 0.204
7HO8 PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z993967070 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	O1J (benzyloxy)acetic acid × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.39 Å R-free 0.197
7HO9 PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1250132788 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	A1A3W (1R)-N-methyl-1-(pyridin-4-yl)propan-1-amine × 1 EDO 1,2-ETHANEDIOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.26 Å R-free 0.199
7HOA PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z275165822 Deposited 2024-11-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 WNY 1-[4-(4-chlorophenyl)piperazin-1-yl]ethan-1-one × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.35 Å R-free 0.201
7HOB PanDDA analysis group deposition -- Crystal Structure of TRIM21, ground state Deposited 2024-11-05	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；4 % PEG 400, 2 M AmmSO4, 0.1 M HEPES pH 8	Resolution 1.15 Å R-free 0.185
9GTE Crystal structure of TRIM21 PRY-SPRY domain bound to Suramin Deposited 2024-09-17	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 291–470（180 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 6 SVR 8,8'-[CARBONYLBIS[IMINO-3,1-PHENYLENECARBONYLIMINO(4-METHYL-3,1-PHENYLENE)CARBONYLIMINO]]BIS-1,3,5-NAPHTHALENETRISULFON IC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；20% PEG 6.000 10% ethylene glycol 0.2 ammonium Chlorid	Resolution 1.30 Å R-free 0.179

112 other PDB entries and 112 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RO52_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 9–188； UniProt 291–470

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7hlk
Deposition date deposition_date	2024-11-04
最后修订 last_revision	2024-11-27
Structure title title	PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z285642082
Keywords keywords	SGC - Diamond I04-1 fragment screening, PanDDA, XChemExplorer, TRIM21, LIGASE; LIGASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	17.00 Å
Radius of gyration Rg (electron density) rg_electron	15.49 Å
Forward intensity I(0) i0	9301920.00
Molecular weight molecular_weight	21778.0 kDa
Excluded volume excluded_volume	26911 Å³
Envelope volume envelope_volume	30138 Å³
Hydration-shell volume shell_volume	15973 Å³
Envelope diameter envelope_diameter	52.0 Å
Shell Rg shell_rg	21.89 Å
Envelope Rg envelope_rg	15.83 Å
Shape Rg shape_rg	15.48 Å
Total Rg total_rg	16.59 Å
Total atoms total_atoms	1536
Residues n_residues	185
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	53.3 Å
Rg (real space) rg_real	16.86 Å
Rg uncertainty (real space) rg_real_error	0.21 Å
I(0) (real space) i0_real	9.3020e+06
I(0) uncertainty (real space) i0_real_error	1.1120e+05
Rg (reciprocal space) rg_reciprocal	16.88 Å
I(0) (reciprocal space) i0_reciprocal	9302000.0000
Solution quality estimate total_estimate	0.8849
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	23.8 Å
Skewness Skewness skewness	0.047
Kurtosis Kurtosis kurtosis	-0.423
Angular range angular_range	— – 0.4700 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	2946000.0000
Real-space data points n_real_points	77
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.845; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.983; Smooth: 0.983

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	E3 ubiquitin-protein ligase TRIM21
Molecular weight formula_weight	21596.4 kDa
EC 编号 ec_number	2.3.2.27
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B
Atom count atom_count	1642

MHHHHHHMVHITLDRNTANSWLIISKDRRQVRMGDTHQNVSDNKERFSNYPMVLGAQRFSSGKMYWEVDVTQKEAWDLGVCRDSVQRKGQFSLSPENGFWTIWLWQDSYEAGTSPQTTLHIQVPPCQIGIFVDYEAGVVSFYNITDHGSLIYTFSECVFAGPLRPFFNVGFNYSGGNAAPLKLCPLKM

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	house mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 non-polymer

Description description	4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID
Molecular weight formula_weight	238.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 non-polymer

Description description	N-cyclopropylpyrazolo[1,5-a]pyrimidine-3-carboxamide
Molecular weight formula_weight	202.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	33

▶

8. Citations (1)

▶

Unit-cell length a length_a	95.708 Å
Unit-cell length b length_b	95.708 Å
Unit-cell length c length_c	45.716 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	I 4
Space-group number int_tables_number	79
Crystal system crystal_system	—

Resolution resolution	1.390 Å
Low-resolution limit resolution_low	31.260 Å
R factor r_factor	0.1897
R_work r_work	0.1886
R_free r_free	0.2122

fit	/app/data/saxs_computation/hl/7hlk/7hlk.fit
pddf	/app/data/pr_computation/hl/7hlk/7hlk.pr.out
profile	/app/data/saxs_computation/hl/7hlk/7hlk.dat