SAXSdb — 7luv

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

THO complex subunit HPR1

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	THO complex subunit THP2 × 1 （O13539） THO complex subunit 2 × 1 （P53552） THO complex subunit MFT1 × 1 （P33441） Tex1 × 1 ATP-dependent RNA helicase SUB2 × 1 （Q07478）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HPR1_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–603； UniProt 1–603

THO complex subunit THP2

Saccharomyces cerevisiae

UniProt O13539

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	THO complex subunit HPR1 × 1 （P17629） THO complex subunit 2 × 1 （P53552） THO complex subunit MFT1 × 1 （P33441） Tex1 × 1 ATP-dependent RNA helicase SUB2 × 1 （Q07478）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	THP2_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–261； UniProt 1–261

THO complex subunit 2

Saccharomyces cerevisiae

UniProt P53552

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	THO complex subunit HPR1 × 1 （P17629） THO complex subunit THP2 × 1 （O13539） THO complex subunit MFT1 × 1 （P33441） Tex1 × 1 ATP-dependent RNA helicase SUB2 × 1 （Q07478）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	THO2_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 6–1262； UniProt 1–1257

THO complex subunit MFT1

Saccharomyces cerevisiae

UniProt P33441

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	THO complex subunit HPR1 × 1 （P17629） THO complex subunit THP2 × 1 （O13539） THO complex subunit 2 × 1 （P53552） Tex1 × 1 ATP-dependent RNA helicase SUB2 × 1 （Q07478）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MFT1_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–256； UniProt 1–256

ATP-dependent RNA helicase SUB2

Saccharomyces cerevisiae

UniProt Q07478

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	THO complex subunit HPR1 × 1 （P17629） THO complex subunit THP2 × 1 （O13539） THO complex subunit 2 × 1 （P53552） THO complex subunit MFT1 × 1 （P33441） Tex1 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SUB2_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain M； PDBConstruct 1–446； UniProt 1–446

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7luv
Deposition date deposition_date	2021-02-23
Structure title title	Cryo-EM structure of the yeast THO-Sub2 complex
Keywords keywords	nuclear mRNA export, DEAD-box ATPase, mRNP remodeling, RNA BINDING PROTEIN; RNA BINDING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7luv__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7luv__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7luv__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	57.22 Å
Rg (electron density)	57.03 Å
Total Rg	56.83 Å
Atom count	18773
Residues	2378
Excluded volume	335690 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7luv__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	THO complex subunit HPR1
Molecular weight formula_weight	71126.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	18773

MSNTEELIQNSIGFLQKTFKALPVSFDSIRHEPLPSSMLHASVLNFEWEPLEKNISAIHDRDSLIDIILKRFIIDSMTNAIEDEEENNLEKGLLNSCIGLDFVYNSRFNRSNPASWGNTFFELFSTIIDLLNSPSTFLKFWPYAESRIEWFKMNTSVEPVSLGESNLISYKQPLYEKLRHWNDILAKLENNDILNTVKHYNMKYKLENFLSELLPINEESNFNRSASISALQESDNEWNRSARERESNRSSDVIFAADYNFVFYHLIICPIEFAFSDLEYKNDVDRSLSPLLDAILEIEENFYSKIKMNNRTRYSLEEALNTEYYANYDVMTPKLPVYMKHSNAMKMDRNEFWANLQNIKESDDYTLRPTIMDISLSNTTCLYKQLTQEDDDYYRKQFILQLCFTTNLIRNLISSDETRNFYKSCYLRENPLSDIDFENLDEVNKKRGLNLCSYICDNRVLKFYKIKDPDFYRVIRKLMSSDEKFTTAKIDGFKEFQNFRISKEKIPPPAFDETFKKFTFIKMGNKLINNVWKIPTGLDKIEQEVKKPEGVYEAAQAKWESKISSETSGGEAKDEIIRQWQTLRFLRSRYLFDFDKVNEKTGV

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 2 Entity 2 polymer

Description description	THO complex subunit THP2
Molecular weight formula_weight	30340.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MTKEEGRTYFESLCEEEQSLQESQTHLLNILDILSVLADPRSSDDLLTESLKKLPDLHRELINSSIRLRYDKYQTREAQLLEDTKTGRDVAAGVQNPKSISEYYSTFEHLNRDTLRYINLLKRLSVDLAKQVEVSDPSVTVYEMDKWVPSEKLQGILEQYCAPDTDIRGVDAQIKNYLDQIKMARAKFGLENKYSLKERLSTLTKELNHWRKEWDDIEMLMFGDDAHSMKKMIQKIDSLKSEINAPSESYPVDKEGDIVLE

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 3 Entity 3 polymer

Description description	THO complex subunit 2
Molecular weight formula_weight	138881.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

GAMGSMAEQTLLSKLNALSQKVIPPASPSQASILTEEVIRNXXXXXXXXXXXXXXXESNDEKEDWLRTLFIELFDFINKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLTTISLCKLIPSLHEELFKFSWISSKLLNKEQTTLLRHLLKKSKYELKKYNLLVENSVGYGQLVALLILAYYDPDNFSKVSAYLKEIYHIMGKYSLDSIRTLDVILNVSSQFITEGYKFFIALLRKSDSWPSSHVANNSNYSSLNEGGNMIAANIISFNLSQYNEEVDKENYERYMDMCCILLKNGFVNFYSIWDNVKPEMEFLQEYIQNLETELEEESTKGVENPLAMAAALSTENETDEDNALVVNDDVNMKDKISEETNADIESKGKQKTQQDILLFGKIKLLERLLIHGCVIPVIHVLKQYPKVLYVSESLSRYLGRVFEYLLNPLYTSMTSSGESKDMATALMITRIDNGILAHKPRLIHKYKTHEPFESLELNSSYVFYYSEWNSNLTPFASVNDLFENSHIYLSIIGPYLGRIPTLLSKISRIGVADIQKNHGSESLHVTIDKWIDYVRKFIFPATSLLQNNPIATSEVYELMKFFPFEKRYFIYNEMMTKLSQDILPLKVSFNKAEREAKSILKALSIDTIAKESRRFAKLISTNPLASLVPAVKQIENYDKVSELVVYTTKYFNDFAYDVLQFVLLLRLTYNRPAVQFDGVNQAMWVQRLSIFIAGLAKNCPNMDISNIITYILKTLHNGNIIAVSILKELIITVGGIRDLNEVNMKQLLMLNSGSPLKQYARHLIYDFRDDNSVISSRLTSFFTDQSAISEIILLLYTLNLKANTQNSHYKILSTRCDEMNTLLWSFIELIKHCLKGKAFEENVLPFVELNNRFHLSTPWTFHIWRDYLDNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLKTLLFCCTSSEAGNLGLFFTDVLKKLEKMRLNGDFNDQASRKLYEWHSVITEQVIDLLSEKNYMSIRNGIEFMKHVTSVFPVVKAHIQLVYTTLEENLINEEREDIKLPSSALIGHLKARLKDALELDEFCTLTEEEAEQKRIREMELEEIKNYETACQNEQKQVALRKQLELNKSQRLQND

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 4 Entity 4 polymer

Description description	THO complex subunit MFT1
Molecular weight formula_weight	29467.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MPLSQKQIDQVRTKVHYSEVDTPFNKYLDILGKVTKLTGSIINGTLSNDDSKIEKLTEQNISQLKESAHLRFLDLQSSIDTKKVADENWETCQQETLAKLENLKDKLPDIKSIHSKLLLRIGKLQGLYDSVQVINREVEGLSEGRTSLVVTRAEWEKELGTDLVKFLIEKNYLKLVDPGLKKDSSEERYRIYDDFSKGPKELESINASMKSDIENVRQEVSSYKEKWLRDAEIFGKITSIFKEELLKRDGLLNEAE

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 5 Entity 5 polymer

Description description	Tex1
Molecular weight formula_weight	41248.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLKFHASGSSMAYSRMDGSLTVWFIKDASFDKSVKVYIPDCCGSDKLATDLSWNPTSLNQMAVVSNSSEISLLLINEITLTASKLRTLSLGSKTKVNSCLYDPLGNWLLAATKSEKIYLFNVKEDHRLVHSLNVNDISPNTNDVVYSIAWNNNGSHIFVGFKSGHLVILKLRDEMLEVSTKIKAHTSSITGIKIDPWGRYFVTGSSDGNCYIWSLKSLCCEKIIQDLDSAVVALDVCHLGKILGVCTEDEMVYFYDLNEAKLLESKSLANHKSDLVLKFYPDKSWYILSGKNDTLSNHFVKNEKNLITYWKDM

Source Source

Source organism organism	Saccharomyces bayanus
NCBI taxonomy ID ncbi_taxonomy_id	4931
Host organism host_organism	Trichoplusia ni

Entity 6 Entity 6 polymer

Description description	ATP-dependent RNA helicase SUB2
Molecular weight formula_weight	50375.9 kDa
EC 编号 ec_number	3.6.4.13
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MSHEGEEDLLEYSDNEQEIQIDASKAAEAGETGAATSATEGDNNNNTAAGDKKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVPGEVAVVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPISKDAELLKNKDTAPHIVVATPGRLKALVREKYIDLSHVKNFVIDECDKVLEELDMRRDVQEIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLEEREKNRKLAQLLDDLEFNQVIIFVKSTTRANELTKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRICVSTDVFGRGIDIERINLAINYDLTNEADQYLHRVGRAGRFGTKGLAISFVSSKEDEEVLAKIQERFDVKIAEFPEEGIDPSTYLNN

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.70 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	30066

Cryo-EM structure of the yeast THO-Sub2 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

THO complex subunit HPR1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

THO complex subunit THP2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

THO complex subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

THO complex subunit MFT1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP-dependent RNA helicase SUB2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7luv__assembly_1__model_1

7luv__assembly_1__model_1 | I(q)

7luv__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 polymer

Polymer Polymer

Source Source

7. Citations (1)