SAXSdb — 7aqo

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

THO complex subunit 2

Saccharomyces cerevisiae S288C

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	THO complex subunit HPR1 × 2 （P17629） TEX1 isoform 1 × 2 （A0A6A5Q4V2） EM14S01-3B_G0007820.mRNA.1.CDS.1 × 2 （A0A6A5Q316） BJ4_G0025130.mRNA.1.CDS.1 × 2 （A0A6A5PZX4） THO complex subunit MFT1 × 2 （P33441）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q535_YEASX
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–1601； UniProt 1–1597 Author chain G； PDBConstruct 5–1601； UniProt 1–1597

THO complex subunit HPR1

Saccharomyces cerevisiae S288C

UniProt P17629

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	THO complex subunit 2 × 2 （A0A6A5Q535） TEX1 isoform 1 × 2 （A0A6A5Q4V2） EM14S01-3B_G0007820.mRNA.1.CDS.1 × 2 （A0A6A5Q316） BJ4_G0025130.mRNA.1.CDS.1 × 2 （A0A6A5PZX4） THO complex subunit MFT1 × 2 （P33441）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HPR1_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–720； UniProt 1–720 Author chain H； PDBConstruct 1–720； UniProt 1–720

TEX1 isoform 1

Saccharomyces cerevisiae S288C

UniProt A0A6A5Q4V2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	THO complex subunit 2 × 2 （A0A6A5Q535） THO complex subunit HPR1 × 2 （P17629） EM14S01-3B_G0007820.mRNA.1.CDS.1 × 2 （A0A6A5Q316） BJ4_G0025130.mRNA.1.CDS.1 × 2 （A0A6A5PZX4） THO complex subunit MFT1 × 2 （P33441）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q4V2_YEASX
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain E； PDBConstruct 1–380； UniProt 1–380 Author chain K； PDBConstruct 1–380； UniProt 1–380

EM14S01-3B_G0007820.mRNA.1.CDS.1

Saccharomyces cerevisiae S288C

UniProt A0A6A5Q316

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	THO complex subunit 2 × 2 （A0A6A5Q535） THO complex subunit HPR1 × 2 （P17629） TEX1 isoform 1 × 2 （A0A6A5Q4V2） BJ4_G0025130.mRNA.1.CDS.1 × 2 （A0A6A5PZX4） THO complex subunit MFT1 × 2 （P33441）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q316_YEASX
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain F； PDBConstruct 5–400； UniProt 51–446 Author chain L； PDBConstruct 5–400； UniProt 51–446

BJ4_G0025130.mRNA.1.CDS.1

Saccharomyces cerevisiae S288C

UniProt A0A6A5PZX4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	THO complex subunit 2 × 2 （A0A6A5Q535） THO complex subunit HPR1 × 2 （P17629） TEX1 isoform 1 × 2 （A0A6A5Q4V2） EM14S01-3B_G0007820.mRNA.1.CDS.1 × 2 （A0A6A5Q316） THO complex subunit MFT1 × 2 （P33441）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5PZX4_YEASX
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain C； PDBConstruct 1–261； UniProt 1–261 Author chain J； PDBConstruct 1–261； UniProt 1–261

THO complex subunit MFT1

Saccharomyces cerevisiae S288C

UniProt P33441

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	THO complex subunit 2 × 2 （A0A6A5Q535） THO complex subunit HPR1 × 2 （P17629） TEX1 isoform 1 × 2 （A0A6A5Q4V2） EM14S01-3B_G0007820.mRNA.1.CDS.1 × 2 （A0A6A5Q316） BJ4_G0025130.mRNA.1.CDS.1 × 2 （A0A6A5PZX4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MFT1_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain D； PDBConstruct 1–392； UniProt 1–392 Author chain I； PDBConstruct 1–392； UniProt 1–392

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7aqo
Deposition date deposition_date	2020-10-22
Structure title title	yeast THO-Sub2 complex dimer
Keywords keywords	yeast THO complex S. cerevisiae THO-Sub2 the transcription-export (TREX) complex, RNA BINDING PROTEIN; RNA BINDING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7aqo__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7aqo__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7aqo__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	79.70 Å
Rg (electron density)	79.94 Å
Total Rg	79.61 Å
Atom count	40251
Residues	5611
Excluded volume	714600 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7aqo__assembly_1__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	THO complex subunit 2
Molecular weight formula_weight	184450.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,A
Atom count atom_count	40261

GAASMAEQTLLSKLNALSQKVIPPASPSQASILTEEVIRNWPERSKTLCSDFTALESNDEKEDWLRTLFIELFDFINKNDENSPLKLSDVASFTNELVNHERQVSQASIVGKMFIAVSSTVPNINDLTTISLCKLIPSLHEELFKFSWISSKLLNKEQTTLLRHLLKKSKYELKKYNLLVENSVGYGQLVALLILAYYDPDNFSKVSAYLKEIYHIMGKYSLDSIRTLDVILNVSSQFITEGYKFFIALLRKSDSWPSSHVANNSNYSSLNEGGNMIAANIISFNLSQYNEEVDKENYERYMDMCCILLKNGFVNFYSIWDNVKPEMEFLQEYIQNLETELEEESTKGVENPLAMAAALSTENETDEDNALVVNDDVNMKDKISEETNADIESKGKQKTQQDILLFGKIKLLERLLIHGCVIPVIHVLKQYPKVLYVSESLSRYLGRVFEYLLNPLYTSMTSSGESKDMATALMITRIDNGILAHKPRLIHKYKTHEPFESLELNSSYVFYYSEWNSNLTPFASVNDLFENSHIYLSIIGPYLGRIPTLLSKISRIGVADIQKNHGSESLHVTIDKWIDYVRKFIFPATSLLQNNPIATSEVYELMKFFPFEKRYFIYNEMMTKLSQDILPLKVSFNKAEREAKSILKALSIDTIAKESRRFAKLISTNPLASLVPAVKQIENYDKVSELVVYTTKYFNDFAYDVLQFVLLLRLTYNRPAVQFDGVNQAMWVQRLSIFIAGLAKNCPNMDISNIITYILKTLHNGNIIAVSILKELIITVGGIRDLNEVNMKQLLMLNSGSPLKQYARHLIYDFRDDNSVISSRLTSFFTDQSAISEIILLLYTLNLKANTQNSHYKILSTRCDEMNTLLWSFIELIKHCLKGKAFEENVLPFVELNNRFHLSTPWTFHIWRDYLDNQLNSNENFSIDELIEGAEFSDVDLTKISKDLFTTFWRLSLYDIHFDKSLYDERKNALSGENTGHMSNRKKHLIQNQIKDILVTGISHQRAFKKTSEFISEKSNVWNKDCGEDQIKIFLQNCVVPRVLFSPSDALFSSFFIFMAFRTENLMSILNTCITSNILKTLLFCCTSSEAGNLGLFFTDVLKKLEKMRLNGDFNDQASRKLYEWHSVITEQVIDLLSEKNYMSIRNGIEFMKHVTSVFPVVKAHIQLVYTTLEENLINEEREDIKLPSSALIGHLKARLKDALELDEFCTLTEEEAEQKRIREMELEEIKNYETACQNEQKQVALRKQLELNKSQRLQNDPPKSVASGSAGLNSKDRYTYSRNEPVIPTKPSSSQWSYSKVTRHVDDINHYLATNHLQKAISLVENDDETRNLRKLSKQNMPIFDFRNSTLEIFERYFRTLIQNPQNPDFAEKIDSLKRYIKNISREPYPDTTSSYSEAAAPEYTKRSSRYSGNAGGKDGYGSSNYRGPSNDRSAPKNIKPISSYAHKRSELPTRPSKSKTYNDRSRALRPTGPDRGDGFDQRDNRLREEYKKNSSQRSQLRFPEKPFQEGKDSSKANPYQASSYKRDSPSENEEKPNKRFKKDETIRNKFQTQDYRNTRDSGAAHRANENQRYNGNRKSNTQALPQGPKGGNYVSRYQR

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Spodoptera frugiperda

Entity 2 Entity 2 polymer

Description description	THO complex subunit HPR1
Molecular weight formula_weight	84544.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,B

MSNTEELIQNSIGFLQKTFKALPVSFDSIRHEPLPSSMLHASVLNFEWEPLEKNISAIHDRDSLIDIILKRFIIDSMTNAIEDEEENNLEKGLLNSCIGLDFVYNSRFNRSNPASWGNTFFELFSTIIDLLNSPSTFLKFWPYAESRIEWFKMNTSVEPVSLGESNLISYKQPLYEKLRHWNDILAKLENNDILNTVKHYNMKYKLENFLSELLPINEESNFNRSASISALQESDNEWNRSARERESNRSSDVIFAADYNFVFYHLIICPIEFAFSDLEYKNDVDRSLSPLLDAILEIEENFYSKIKMNNRTRYSLEEALNTEYYANYDVMTPKLPVYMKHSNAMKMDRNEFWANLQNIKESDDYTLRPTIMDISLSNTTCLYKQLTQEDDDYYRKQFILQLCFTTNLIRNLISSDETRNFYKSCYLRENPLSDIDFENLDEVNKKRGLNLCSYICDNRVLKFYKIKDPDFYRVIRKLMSSDEKFTTAKIDGFKEFQNFRISKEKIPPPAFDETFKKFTFIKMGNKLINNVWKIPTGLDKIEQEVKKPEGVYEAAQAKWESKISSETSGGEAKDEIIRQWQTLRFLRSRYLFDFDKVNEKTGVDGLFEEPRKVEALDDSFKEKLLYKINQEHRKKLQDAREYKIGKERKKRALEEEASFPEREQKIKSQRINSASQTEGDELKSEQTQPKGEISEENTKIKSSEVSSQDPDSGVAGEFAP

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Spodoptera frugiperda

Entity 3 Entity 3 polymer

Description description	TEX1 isoform 1
Molecular weight formula_weight	42315.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,E

MSTIGAVDILNQKTITSEVAASVTSKYLQSTFSKGNTSHIEDKRFIHVSSRSHSRFTSTPITPNEILSLKFHVSGSSMAYSRMDGSLTVWFIKDASFDKSVEVYIPDCCGSDKLATDLSWNPTSLNQIAVVSNSSEISLLLINEKSLTASKLRTLSLGSKTKVNTCLYDPLGNWLLAATKSEKIYLFDVKKDHSSVCSLNISDISQEDNDVVYSLAWSNGGSHIFIGFKSGYLAILKAKHGILEVCTKIKAHTGPITEIKMDPWGRNFITGSIDGNCYVWNMKSLCCELIINDLNSAVTTLDVCHLGKILGICTEDEMVYFYDLNSGNLLHSKSLANYKTDPVLKFYPDKSWYIMSGKNDTLSNHFVKNEKNLITYWKDM

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Spodoptera frugiperda

Entity 4 Entity 4 polymer

Description description	EM14S01-3B_G0007820.mRNA.1.CDS.1
Molecular weight formula_weight	45521.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,F

GAASDKKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVPGEVAVVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPISKDAELLKNKDTAPHIVVATPGRLKALVREKYIDLSHVKNFVIDECDKVLEELDMRRDVQEIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLEEREKNRKLAQLLDDLEFNQVIIFVKSTTRANELTKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRICVSTDVFGRGIDIERINLAINYDLTNEADQYLHRVGRAGRFGTKGLAISFVSSKEDEEVLAKIQERFDVKIAEFPEEGIDPSTYLNN

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Spodoptera frugiperda

Entity 5 Entity 5 polymer

Description description	BJ4_G0025130.mRNA.1.CDS.1
Molecular weight formula_weight	30340.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,C

MTKEEGRTYFESLCEEEQSLQESQTHLLNILDILSVLADPRSSDDLLTESLKKLPDLHRELINSSIRLRYDKYQTREAQLLEDTKTGRDVAAGVQNPKSISEYYSTFEHLNRDTLRYINLLKRLSVDLAKQVEVSDPSVTVYEMDKWVPSEKLQGILEQYCAPDTDIRGVDAQIKNYLDQIKMARAKFGLENKYSLKERLSTLTKELNHWRKEWDDIEMLMFGDDAHSMKKMIQKIDSLKSEINAPSESYPVDKEGDIVLE

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Spodoptera frugiperda

Entity 6 Entity 6 polymer

Description description	THO complex subunit MFT1
Molecular weight formula_weight	45055.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,D

MPLSQKQIDQVRTKVHYSEVDTPFNKYLDILGKVTKLTGSIINGTLSNDDSKIEKLTEQNISQLKESAHLRFLDLQSSIDTKKVADENWETCQQETLAKLENLKDKLPDIKSIHSKLLLRIGKLQGLYDSVQVINREVEGLSEGRTSLVVTRAEWEKELGTDLVKFLIEKNYLKLVDPGLKKDSSEERYRIYDDFSKGPKELESINASMKSDIENVRQEVSSYKEKWLRDAEIFGKITSIFKEELLKRDGLLNEAEGDNIDEDYESDEDEERKERFKRQRSMVEVNTIENVDEKEESDHEYDDQEDEENEEEDDMEVDVEDIKEDNEVDGESSQQEDNSRQGNNEETDKETGVIEEPDAVNDAEEADSDHSSRKLGGTTSDFSASSSVEEVK

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Spodoptera frugiperda

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	113076

yeast THO-Sub2 complex dimer

1. Protein Identity and Related Structures Protein Identity & Related Structures

THO complex subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

THO complex subunit HPR1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

TEX1 isoform 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

EM14S01-3B_G0007820.mRNA.1.CDS.1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

BJ4_G0025130.mRNA.1.CDS.1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

THO complex subunit MFT1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7aqo__assembly_1__model_1

7aqo__assembly_1__model_1 | I(q)

7aqo__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 polymer

Polymer Polymer

Source Source

7. Citations (1)