SAXSdb — 7lvs

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone lysine acetyltransferase CREBBP

Mus musculus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 2	Cbp/p300-interacting transactivator 2,Hypoxia-inducible factor 1-alpha × 1 （Q16665,Q99967） ZINC ION × 3 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CBP_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 1–100； UniProt 340–439

Cbp/p300-interacting transactivator 2,Hypoxia-inducible factor 1-alpha

Homo sapiens

UniProt Q16665

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 2	Histone lysine acetyltransferase CREBBP × 1 （P45481） ZINC ION × 3 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HIF1A_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain F； PDBConstruct 37–67； UniProt 796–826

Cbp/p300-interacting transactivator 2,Hypoxia-inducible factor 1-alpha

Homo sapiens

UniProt Q99967

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 2	Histone lysine acetyltransferase CREBBP × 1 （P45481） ZINC ION × 3 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CITE2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain F； PDBConstruct 6–36； UniProt 216–246

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7lvs
Deposition date deposition_date	2021-02-26
Structure title title	The CBP TAZ1 Domain in Complex with a CITED2-HIF-1-Alpha Fusion Peptide
Keywords keywords	Complex, Intrinsically Disordered Protein, TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7lvs__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7lvs__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7lvs__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	16.28 Å
Rg (electron density)	14.86 Å
Total Rg	15.90 Å
Atom count	2423
Residues	155
Excluded volume	21527 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7lvs__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Histone lysine acetyltransferase CREBBP
Molecular weight formula_weight	11281.2 kDa
EC 编号 ec_number	2.3.1.48,2.3.1.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B
Atom count atom_count	2459

ATGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKR

Source Source

Source organism organism	Mus musculus
Common name common_name	Mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Cbp/p300-interacting transactivator 2,Hypoxia-inducible factor 1-alpha
Molecular weight formula_weight	7523.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

GSHMSNVIDTDFIDEEVLMSLVIEMGLDRIKELPELTSYDCEVNAPIQGSRNLLQGEELLRALDQVN

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	36

▼

6. Fold Classification (SCOP + CATH) 1 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d7lvsb_
Class class	g — Small proteins
Fold Fold fold	g.53 — TAZ domain
Superfamily Superfamily superfamily	g.53.1 — TAZ domain
Family Family family	g.53.1.1 — TAZ domain

▶

Unit-cell length a length_a	32.061 Å
Unit-cell length b length_b	50.112 Å
Unit-cell length c length_c	41.255 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	99.19 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	monoclinic

Resolution resolution	2.020 Å
Low-resolution limit resolution_low	40.730 Å
R factor r_factor	0.2137
R_work r_work	0.2107
R_free r_free	0.2406

The CBP TAZ1 Domain in Complex with a CITED2-HIF-1-Alpha Fusion Peptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone lysine acetyltransferase CREBBP

State in the Current Structure

Other States of the Same Protein in the Database

Cbp/p300-interacting transactivator 2,Hypoxia-inducible factor 1-alpha

State in the Current Structure

Other States of the Same Protein in the Database

Cbp/p300-interacting transactivator 2,Hypoxia-inducible factor 1-alpha

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7lvs__assembly_1__model_1

7lvs__assembly_1__model_1 | I(q)

7lvs__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 1 domains

SCOP 2.08 (1 domains)

7. Citations (1)

The CBP TAZ1 Domain in Complex with a CITED2-HIF-1-Alpha Fusion Peptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone lysine acetyltransferase CREBBP

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cbp/p300-interacting transactivator 2,Hypoxia-inducible factor 1-alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cbp/p300-interacting transactivator 2,Hypoxia-inducible factor 1-alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7lvs__assembly_1__model_1

7lvs__assembly_1__model_1 | I(q)

7lvs__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 1 domains

SCOP 2.08 (1 domains)

7. Citations (1)