SAXSdb — 7qgs

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cbp/p300-interacting transactivator 2,Hypoxia-inducible factor 1-alpha

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 2	Histone acetyltransferase × 1 （Q7Z6C1） ZINC ION × 3 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HIF1A_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 24–58； UniProt 792–826

Cbp/p300-interacting transactivator 2,Hypoxia-inducible factor 1-alpha

OrganismNot specified

UniProt Q99967

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 2	Histone acetyltransferase × 1 （Q7Z6C1） ZINC ION × 3 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CITE2_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 5–23； UniProt 224–242

Histone acetyltransferase

Homo sapiens

UniProt Q7Z6C1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 2	Cbp/p300-interacting transactivator 2,Hypoxia-inducible factor 1-alpha × 1 （Q16665,Q99967） ZINC ION × 3 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7Z6C1_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 6–96； UniProt 330–420

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7qgs
Deposition date deposition_date	2021-12-10
Structure title title	Crystal structure of p300 CH1 domain in complex with CITIF (a CITED2-HIF-1alpha hybrid)
Keywords keywords	hypoxia, transcription factor, intrinsically disordered protein, PROTEIN BINDING; PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7qgs__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7qgs__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7qgs__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	15.90 Å
Rg (electron density)	14.46 Å
Total Rg	15.47 Å
Atom count	1169
Residues	148
Excluded volume	20637 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7qgs__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Cbp/p300-interacting transactivator 2,Hypoxia-inducible factor 1-alpha
Molecular weight formula_weight	6402.2 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B
Atom count atom_count	1210

GPGSDEEVLMSLVIEMGLDRIKELPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN

Entity 2 Entity 2 polymer

Description description	Histone acetyltransferase
Molecular weight formula_weight	10892.7 kDa
EC 编号 ec_number	2.3.1.48
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

GPIGSADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNA

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	41

▶

Unit-cell length a length_a	30.505 Å
Unit-cell length b length_b	48.599 Å
Unit-cell length c length_c	39.825 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	103.87 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	monoclinic

Resolution resolution	2.000 Å
Low-resolution limit resolution_low	38.660 Å
R factor r_factor	0.2221
R_work r_work	0.2208
R_free r_free	0.2450

Crystal structure of p300 CH1 domain in complex with CITIF (a CITED2-HIF-1alpha hybrid)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cbp/p300-interacting transactivator 2,Hypoxia-inducible factor 1-alpha

State in the Current Structure

Other States of the Same Protein in the Database

Cbp/p300-interacting transactivator 2,Hypoxia-inducible factor 1-alpha

State in the Current Structure

Other States of the Same Protein in the Database

Histone acetyltransferase

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7qgs__assembly_1__model_1

7qgs__assembly_1__model_1 | I(q)

7qgs__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)

Crystal structure of p300 CH1 domain in complex with CITIF (a CITED2-HIF-1alpha hybrid)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cbp/p300-interacting transactivator 2,Hypoxia-inducible factor 1-alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cbp/p300-interacting transactivator 2,Hypoxia-inducible factor 1-alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone acetyltransferase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7qgs__assembly_1__model_1

7qgs__assembly_1__model_1 | I(q)

7qgs__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)