7m2t

Crystallographic Structure of the Monoclinic Form of Satellite Tobacco Mosaic Virus

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Coat protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Homooligomer	Protein 60 RNA 158	;RNA (5'-R(PAPAPAPAPAPAPAPAPAPAPAPA)-3') ; × 60 RNA (27-mer) × 98 MAGNESIUM ION × 12 PHOSPHATE ION × 12 SULFATE ION × 10 water × 160	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COAT_STMV
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–159； UniProt 1–159 Author chain B； PDBConstruct 1–159； UniProt 1–159 Author chain BB； PDBConstruct 1–159； UniProt 1–159 Author chain C； PDBConstruct 1–159； UniProt 1–159 Author chain CC； PDBConstruct 1–159； UniProt 1–159 Author chain D； PDBConstruct 1–159； UniProt 1–159 Author chain DD； PDBConstruct 1–159； UniProt 1–159 Author chain E； PDBConstruct 1–159； UniProt 1–159 Author chain EE； PDBConstruct 1–159； UniProt 1–159 Author chain F； PDBConstruct 1–159； UniProt 1–159 Author chain FF； PDBConstruct 1–159； UniProt 1–159 Author chain G； PDBConstruct 1–159； UniProt 1–159 Author chain GG； PDBConstruct 1–159； UniProt 1–159 Author chain H； PDBConstruct 1–159； UniProt 1–159 Author chain HH； PDBConstruct 1–159； UniProt 1–159 Author chain I； PDBConstruct 1–159； UniProt 1–159 Author chain II； PDBConstruct 1–159； UniProt 1–159 Author chain J； PDBConstruct 1–159； UniProt 1–159 Author chain JJ； PDBConstruct 1–159； UniProt 1–159 Author chain K； PDBConstruct 1–159； UniProt 1–159 Author chain KK； PDBConstruct 1–159； UniProt 1–159 Author chain L； PDBConstruct 1–159； UniProt 1–159 Author chain LL； PDBConstruct 1–159； UniProt 1–159 Author chain M； PDBConstruct 1–159； UniProt 1–159 Author chain MM； PDBConstruct 1–159； UniProt 1–159 Author chain N； PDBConstruct 1–159； UniProt 1–159 Author chain NN； PDBConstruct 1–159； UniProt 1–159 Author chain O； PDBConstruct 1–159； UniProt 1–159 Author chain OO； PDBConstruct 1–159； UniProt 1–159 Author chain PP； PDBConstruct 1–159； UniProt 1–159

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7m2t
Deposition date deposition_date	2021-03-17
Structure title title	Crystallographic Structure of the Monoclinic Form of Satellite Tobacco Mosaic Virus
Keywords keywords	VIRUS-RNA complex; VIRUS/RNA
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7m2t__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7m2t__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7m2t__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	69.66 Å
Rg (electron density)	70.81 Å
Total Rg	70.67 Å
Atom count	80852
Residues	9308
Excluded volume	1385900 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7m2t__assembly_1__model_1`	218-meric （218）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Coat protein
Molecular weight formula_weight	17533.9 kDa
Source method src_method	nat
Copy count entity_count	30

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,BB,CC,DD,EE,FF,GG,HH,II,JJ,KK,LL,MM,NN,OO,PP
Atom count atom_count	49909

MGRGKVKPNRKSTGDNSNVVTMIRAGSYPKVNPTPTWVRAIPFEVSVQSGIAFKVPVGSLFSANFRTDSFTSVTVMSVRAWTQLTPPVNEYSFVRLKPLFKTGDSTEEFEGRASNINTRASVGYRIPTNLRQNTVAADNVCEVRSNCRQVALVISCCFN

Entity 2 Entity 2 polymer

Description description	;RNA (5'-R(PAPAPAPAPAPAPAPAPAPAPAPA)-3') ;
Molecular weight formula_weight	3905.5 kDa
Source method src_method	nat
Copy count entity_count	30

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	P,Q,R,S,T,U,V,W,X,Y,Z,a,b,c,d,QQ,RR,SS,TT,UU,VV,WW,YY,ZZ,bb,cc,dd,ee,ff,gg

AAAAAAAAAAAA

Entity 3 Entity 3 polymer

Description description	RNA (27-mer)
Molecular weight formula_weight	8221.5 kDa
Source method src_method	nat
Copy count entity_count	49

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	e,f,g,h,i,j,k,l,m,n,o,p,q,r,s,t,u,v,w,x,y,z,1,2,3,4,5,6,7,8,hh,ii,jj,kk,ll,mm,nn,oo,pp,qq,rr,ss,tt,uu,vv,ww,xx,yy,zz

UUUUUUUUUUUUUUUUUUUUUUUUUUU

Entity 4 Entity 4 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 5 Entity 5 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 6 Entity 6 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 7 Entity 7 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	2797

▶

Unit-cell length a length_a	175.760 Å
Unit-cell length b length_b	169.860 Å
Unit-cell length c length_c	244.560 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	92.69 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	196

Space group space_group	I 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	2.710 Å
Low-resolution limit resolution_low	49.950 Å
R factor r_factor	0.1316
R_work r_work	0.1292
R_free r_free	0.1767

Crystallographic Structure of the Monoclinic Form of Satellite Tobacco Mosaic Virus

1. Protein Identity and Related Structures Protein Identity & Related Structures

Coat protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7m2t__assembly_1__model_1

7m2t__assembly_1__model_1 | I(q)

7m2t__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

7. Citations (1)

Crystallographic Structure of the Monoclinic Form of Satellite Tobacco Mosaic Virus

1. Protein Identity and Related Structures Protein Identity & Related Structures

Coat protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7m2t__assembly_1__model_1

7m2t__assembly_1__model_1 | I(q)

7m2t__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

7. Citations (1)