SAXSdb — 7mue

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DotF

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 72	Type IV secretion protein IcmK × 18 （A0A2S6FBG9） Unknown protein fragment × 18 IcmE protein × 18 （O53087）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	O54615_LEGPN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain AF； PDBConstruct 1–269； UniProt 1–269 Author chain BF； PDBConstruct 1–269； UniProt 1–269 Author chain CF； PDBConstruct 1–269； UniProt 1–269 Author chain DF； PDBConstruct 1–269； UniProt 1–269 Author chain EF； PDBConstruct 1–269； UniProt 1–269 Author chain FF； PDBConstruct 1–269； UniProt 1–269 Author chain GF； PDBConstruct 1–269； UniProt 1–269 Author chain HF； PDBConstruct 1–269； UniProt 1–269 Author chain IF； PDBConstruct 1–269； UniProt 1–269 Author chain JF； PDBConstruct 1–269； UniProt 1–269 Author chain KF； PDBConstruct 1–269； UniProt 1–269 Author chain LF； PDBConstruct 1–269； UniProt 1–269 Author chain MF； PDBConstruct 1–269； UniProt 1–269 Author chain VF； PDBConstruct 1–269； UniProt 1–269 Author chain WF； PDBConstruct 1–269； UniProt 1–269 Author chain XF； PDBConstruct 1–269； UniProt 1–269 Author chain YF； PDBConstruct 1–269； UniProt 1–269 Author chain ZF； PDBConstruct 1–269； UniProt 1–269

Type IV secretion protein IcmK

OrganismNot specified

UniProt A0A2S6FBG9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 72	DotF × 18 （O54615） Unknown protein fragment × 18 IcmE protein × 18 （O53087）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2S6FBG9_LEGPN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain AH； PDBConstruct 1–361； UniProt 1–361 Author chain BH； PDBConstruct 1–361； UniProt 1–361 Author chain CH； PDBConstruct 1–361； UniProt 1–361 Author chain DH； PDBConstruct 1–361； UniProt 1–361 Author chain EH； PDBConstruct 1–361； UniProt 1–361 Author chain FH； PDBConstruct 1–361； UniProt 1–361 Author chain GH； PDBConstruct 1–361； UniProt 1–361 Author chain HH； PDBConstruct 1–361； UniProt 1–361 Author chain IH； PDBConstruct 1–361； UniProt 1–361 Author chain JH； PDBConstruct 1–361； UniProt 1–361 Author chain KH； PDBConstruct 1–361； UniProt 1–361 Author chain LH； PDBConstruct 1–361； UniProt 1–361 Author chain MH； PDBConstruct 1–361； UniProt 1–361 Author chain VH； PDBConstruct 1–361； UniProt 1–361 Author chain WH； PDBConstruct 1–361； UniProt 1–361 Author chain XH； PDBConstruct 1–361； UniProt 1–361 Author chain YH； PDBConstruct 1–361； UniProt 1–361 Author chain ZH； PDBConstruct 1–361； UniProt 1–361

IcmE protein

OrganismNot specified

UniProt O53087

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 72	DotF × 18 （O54615） Type IV secretion protein IcmK × 18 （A0A2S6FBG9） Unknown protein fragment × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	O53087_LEGPN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain AG； PDBConstruct 1–1048； UniProt 1–1048 Author chain BG； PDBConstruct 1–1048； UniProt 1–1048 Author chain CG； PDBConstruct 1–1048； UniProt 1–1048 Author chain DG； PDBConstruct 1–1048； UniProt 1–1048 Author chain EG； PDBConstruct 1–1048； UniProt 1–1048 Author chain FG； PDBConstruct 1–1048； UniProt 1–1048 Author chain GG； PDBConstruct 1–1048； UniProt 1–1048 Author chain HG； PDBConstruct 1–1048； UniProt 1–1048 Author chain IG； PDBConstruct 1–1048； UniProt 1–1048 Author chain JG； PDBConstruct 1–1048； UniProt 1–1048 Author chain KG； PDBConstruct 1–1048； UniProt 1–1048 Author chain LG； PDBConstruct 1–1048； UniProt 1–1048 Author chain MG； PDBConstruct 1–1048； UniProt 1–1048 Author chain VG； PDBConstruct 1–1048； UniProt 1–1048 Author chain WG； PDBConstruct 1–1048； UniProt 1–1048 Author chain XG； PDBConstruct 1–1048； UniProt 1–1048 Author chain YG； PDBConstruct 1–1048； UniProt 1–1048 Author chain ZG； PDBConstruct 1–1048； UniProt 1–1048

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7mue
Deposition date deposition_date	2021-05-14
Structure title title	Legionella pneumophila Dot/Icm T4SS PR
Keywords keywords	Dot/Icm, Secretion, T4SS, TRANSLOCASE; TRANSLOCASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7mue__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7mue__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7mue__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	76.44 Å
Rg (electron density)	75.78 Å
Total Rg	75.93 Å
Atom count	40266
Residues	5490
Excluded volume	714520 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7mue__assembly_1__model_1`	72-meric （72）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	DotF
Molecular weight formula_weight	29730.0 kDa
Source method src_method	nat
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AF,BF,CF,DF,EF,FF,GF,HF,IF,JF,KF,LF,MF,VF,WF,XF,YF,ZF
Atom count atom_count	40266

MMAEHDQNNDEYKFAELDSYDMDQAGESDLDSEASYQSGKEGLTKKKDIKRNALIAIGAVVFIMVMYKIIGWMFFSDKSSQVTSKPAIPPVTQVATPQPVQTIPTTTPIQQVQPTTIIEDDPDLKKKVSAIEMTQQSLRSEVNALSEQINAVNNNIKNLNAQIVNLNQIIGNMSNQIARQSEVINVLMARTTPKKVVKVSRPIVQARIIYYIQAVIPGRAWLIGSNGSTLTVREGSKIPGYGMVKLIDSLQGRILTSSGQVIKFSQEDS

Entity 2 Entity 2 polymer

Description description	Type IV secretion protein IcmK
Molecular weight formula_weight	38958.9 kDa
Source method src_method	nat
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	XH,YH,ZH,AH,BH,CH,DH,EH,FH,GH,HH,IH,JH,KH,LH,MH,VH,WH

MMKKYDQLCKYCLVIGLTFSMSCSIYAADQSDDAQQALQQLRMLQQKLSQNPSPDAQSGAGDGGDNAASDSTQQPNQSGQANAPAANQTATAGGDGQIISQDDAEVIDKKAFKDMTRNLYPLNPEQVVKLKQIYETSEYAKAATPGTPPKPTATSQFVNLSPGSTPPVIRLSQGFVSSLVFLDSTGAPWPIAAYDLGDPSSFNIQWDKTSNTLMIQATKLYNYGNLAVRLRGLNTPVMLTLIPGQKAVDYRVDLRVQGYGPNAKSMPTEEGIPPSANDLLLHVLEGVPPPGSRRLVVSGGDARAWLSNEKMYVRTNLTILSPGWLASMTSADGTHAYEMQKSPVLLVSWHGKVMQLKVEGL

Entity 3 Entity 3 polymer

Description description	Unknown protein fragment
Molecular weight formula_weight	4103.0 kDa
Source method src_method	nat
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AX,BX,CX,DX,EX,FX,GX,HX,IX,JX,KX,LX,MX,VX,WX,XX,YX,ZX

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 4 Entity 4 polymer

Description description	IcmE protein
Molecular weight formula_weight	107911.9 kDa
Source method src_method	nat
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	IG,AG,BG,CG,DG,EG,FG,GG,HG,JG,KG,LG,MG,VG,WG,XG,YG,ZG

MASKKENLKSLFSNTRTRVIIIFTAALLIIAVVIGFFKIRGATTGSIAAAEVSTVPGGIQSIPGVLDPTAQYAKLQEEQNITQAQVAEKTGGSAIPTIIRTQALGEGVGVIGSQSGVGFAALAQEELGGPQRSLWIQELQDGSCSKSVITKVVNQGAQLTDLKAACSCVQLKDSGYGLQELEQVCECKELKSAGYNARQLKEAGYSAGRLRNCGFDACELRNAGFTAQEMKDGGFSDGELKGAGFSDAEIAKASGLPDGITADDVRKAGCGAAALAKLRQAGVSASAIRKISGCTAEQLKAAGYTAKELKDAGFSAADLRRAGFSAAELKDAGFTARDLLNAGFTPADLAKAGFSDAQIKAAQAELPPGITPQDVKNAGCDVEALKKEREAGVSAALIRQYAGCSAQALKAAGFTDADLANAGFTPAQISAATPLSDAEIKAAGCDPDKLKKLFSAGVSAKRIKELNGCSAEALKAAGYDAQSLLAAGFTPQELLAAGFTPKQLEDAGLNPVSIIADGRVADCSVESLKKARAAGVSALTIKQTLGCSAAALKAAGYTAKELKDAGFTAAELKAAGFSAKELKDAGFTAKELRDAGFSAQELKDVGFSAKDLKDAGFSAAELKAAGFTAAQLKAAGFSAKDLKDAGFSAAELKAAGFSAKELKDAGFSASDLKNAGFSAKELKDAGFSASDLKSAGFSASELKNAGYSADELKKAGYTSAELRNAGFSPQESAVAGLQGPDLQQLDSSITGIPSIPGATPRPTTSDAASSAEQLQAILQKQNEQLAEQKYQQEIQQRTSDMLTAATQLVQDWKQVETQVYTEGTEETKTSGGESAVPGTGTGTGSNNQPVDQGAVSAQNQAIIKTGDIMFAVLDTSVNSDEPGPILATIVTGKLKGSKLIGSFNLPSNADKMVITFNTMSIPGAEKTISISAYAIDPNTARTALASRTNHHYLMRYGSLFASSFLQGFGNAFQSANTTITIGGTGGGNNITVANGVGRSTLENAVIGLATVGKAWSQQAQQLFNTPTTVEVYSGTGLGILFTQDVTTI

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	2.80 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	43907

Legionella pneumophila Dot/Icm T4SS PR

1. Protein Identity and Related Structures Protein Identity & Related Structures

DotF

State in the Current Structure

Other States of the Same Protein in the Database

Type IV secretion protein IcmK

State in the Current Structure

Other States of the Same Protein in the Database

IcmE protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7mue__assembly_1__model_1

7mue__assembly_1__model_1 | I(q)

7mue__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

7. Citations (1)

Legionella pneumophila Dot/Icm T4SS PR

1. Protein Identity and Related Structures Protein Identity & Related Structures

DotF

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Type IV secretion protein IcmK

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

IcmE protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7mue__assembly_1__model_1

7mue__assembly_1__model_1 | I(q)

7mue__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

7. Citations (1)