7muq

Reconstruction of the Legionella pneumophila Dot/Icm T4SS 3DVA Map 1

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

IcmE protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 205	DotC × 13 （O52184） DotF × 31 （O54615） DotD × 26 （O52183） Type IV secretion protein IcmK × 18 （A0A2S6FBG9） Inner membrane lipoprotein YiaD × 13 （O53086） Outer membrane protein, OmpA family protein × 13 （Q5ZXS4） DUF2807 domain-containing protein × 13 （A0A2S6F0F8） Neurogenic locus notch × 13 （A0A2S6FAR3） Unknown protein fragment × 13 Unknown protein fragment × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	O53087_LEGPN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain AG； PDBConstruct 1–1048； UniProt 1–1048 Author chain Ag； PDBConstruct 1–1048； UniProt 1–1048 Author chain BG； PDBConstruct 1–1048； UniProt 1–1048 Author chain Bg； PDBConstruct 1–1048； UniProt 1–1048 Author chain CG； PDBConstruct 1–1048； UniProt 1–1048 Author chain Cg； PDBConstruct 1–1048； UniProt 1–1048 Author chain DG； PDBConstruct 1–1048； UniProt 1–1048 Author chain Dg； PDBConstruct 1–1048； UniProt 1–1048 Author chain EG； PDBConstruct 1–1048； UniProt 1–1048 Author chain Eg； PDBConstruct 1–1048； UniProt 1–1048 Author chain FG； PDBConstruct 1–1048； UniProt 1–1048 Author chain Fg； PDBConstruct 1–1048； UniProt 1–1048 Author chain GG； PDBConstruct 1–1048； UniProt 1–1048 Author chain Gg； PDBConstruct 1–1048； UniProt 1–1048 Author chain HG； PDBConstruct 1–1048； UniProt 1–1048 Author chain Hg； PDBConstruct 1–1048； UniProt 1–1048 Author chain IG； PDBConstruct 1–1048； UniProt 1–1048 Author chain Ig； PDBConstruct 1–1048； UniProt 1–1048 Author chain JG； PDBConstruct 1–1048； UniProt 1–1048 Author chain Jg； PDBConstruct 1–1048； UniProt 1–1048 Author chain KG； PDBConstruct 1–1048； UniProt 1–1048 Author chain Kg； PDBConstruct 1–1048； UniProt 1–1048 Author chain LG； PDBConstruct 1–1048； UniProt 1–1048 Author chain Lg； PDBConstruct 1–1048； UniProt 1–1048 Author chain MG； PDBConstruct 1–1048； UniProt 1–1048 Author chain Mg； PDBConstruct 1–1048； UniProt 1–1048 Author chain NG； PDBConstruct 1–1048； UniProt 1–1048 Author chain OG； PDBConstruct 1–1048； UniProt 1–1048 Author chain PG； PDBConstruct 1–1048； UniProt 1–1048 Author chain VG； PDBConstruct 1–1048； UniProt 1–1048 Author chain WG； PDBConstruct 1–1048； UniProt 1–1048 Author chain XG； PDBConstruct 1–1048； UniProt 1–1048 Author chain YG； PDBConstruct 1–1048； UniProt 1–1048 Author chain ZG； PDBConstruct 1–1048； UniProt 1–1048

DotC

OrganismNot specified

UniProt O52184

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 205	IcmE protein × 34 （O53087） DotF × 31 （O54615） DotD × 26 （O52183） Type IV secretion protein IcmK × 18 （A0A2S6FBG9） Inner membrane lipoprotein YiaD × 13 （O53086） Outer membrane protein, OmpA family protein × 13 （Q5ZXS4） DUF2807 domain-containing protein × 13 （A0A2S6F0F8） Neurogenic locus notch × 13 （A0A2S6FAR3） Unknown protein fragment × 13 Unknown protein fragment × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	O52184_LEGPN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain AC； PDBConstruct 1–303； UniProt 1–303 Author chain BC； PDBConstruct 1–303； UniProt 1–303 Author chain CC； PDBConstruct 1–303； UniProt 1–303 Author chain DC； PDBConstruct 1–303； UniProt 1–303 Author chain EC； PDBConstruct 1–303； UniProt 1–303 Author chain FC； PDBConstruct 1–303； UniProt 1–303 Author chain GC； PDBConstruct 1–303； UniProt 1–303 Author chain HC； PDBConstruct 1–303； UniProt 1–303 Author chain IC； PDBConstruct 1–303； UniProt 1–303 Author chain JC； PDBConstruct 1–303； UniProt 1–303 Author chain KC； PDBConstruct 1–303； UniProt 1–303 Author chain LC； PDBConstruct 1–303； UniProt 1–303 Author chain MC； PDBConstruct 1–303； UniProt 1–303

DotF

OrganismNot specified

UniProt O54615

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 205	IcmE protein × 34 （O53087） DotC × 13 （O52184） DotD × 26 （O52183） Type IV secretion protein IcmK × 18 （A0A2S6FBG9） Inner membrane lipoprotein YiaD × 13 （O53086） Outer membrane protein, OmpA family protein × 13 （Q5ZXS4） DUF2807 domain-containing protein × 13 （A0A2S6F0F8） Neurogenic locus notch × 13 （A0A2S6FAR3） Unknown protein fragment × 13 Unknown protein fragment × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	O54615_LEGPN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain AF； PDBConstruct 1–269； UniProt 1–269 Author chain Af； PDBConstruct 1–269； UniProt 1–269 Author chain BF； PDBConstruct 1–269； UniProt 1–269 Author chain Bf； PDBConstruct 1–269； UniProt 1–269 Author chain CF； PDBConstruct 1–269； UniProt 1–269 Author chain Cf； PDBConstruct 1–269； UniProt 1–269 Author chain DF； PDBConstruct 1–269； UniProt 1–269 Author chain Df； PDBConstruct 1–269； UniProt 1–269 Author chain EF； PDBConstruct 1–269； UniProt 1–269 Author chain Ef； PDBConstruct 1–269； UniProt 1–269 Author chain FF； PDBConstruct 1–269； UniProt 1–269 Author chain Ff； PDBConstruct 1–269； UniProt 1–269 Author chain GF； PDBConstruct 1–269； UniProt 1–269 Author chain Gf； PDBConstruct 1–269； UniProt 1–269 Author chain HF； PDBConstruct 1–269； UniProt 1–269 Author chain Hf； PDBConstruct 1–269； UniProt 1–269 Author chain IF； PDBConstruct 1–269； UniProt 1–269 Author chain If； PDBConstruct 1–269； UniProt 1–269 Author chain JF； PDBConstruct 1–269； UniProt 1–269 Author chain Jf； PDBConstruct 1–269； UniProt 1–269 Author chain KF； PDBConstruct 1–269； UniProt 1–269 Author chain Kf； PDBConstruct 1–269； UniProt 1–269 Author chain LF； PDBConstruct 1–269； UniProt 1–269 Author chain Lf； PDBConstruct 1–269； UniProt 1–269 Author chain MF； PDBConstruct 1–269； UniProt 1–269 Author chain Mf； PDBConstruct 1–269； UniProt 1–269 Author chain VF； PDBConstruct 1–269； UniProt 1–269 Author chain WF； PDBConstruct 1–269； UniProt 1–269 Author chain XF； PDBConstruct 1–269； UniProt 1–269 Author chain YF； PDBConstruct 1–269； UniProt 1–269 Author chain ZF； PDBConstruct 1–269； UniProt 1–269

DotD

OrganismNot specified

UniProt O52183

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 205	IcmE protein × 34 （O53087） DotC × 13 （O52184） DotF × 31 （O54615） Type IV secretion protein IcmK × 18 （A0A2S6FBG9） Inner membrane lipoprotein YiaD × 13 （O53086） Outer membrane protein, OmpA family protein × 13 （Q5ZXS4） DUF2807 domain-containing protein × 13 （A0A2S6F0F8） Neurogenic locus notch × 13 （A0A2S6FAR3） Unknown protein fragment × 13 Unknown protein fragment × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	O52183_LEGPN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain AD； PDBConstruct 1–163； UniProt 1–163 Author chain Ad； PDBConstruct 1–163； UniProt 1–163 Author chain BD； PDBConstruct 1–163； UniProt 1–163 Author chain Bd； PDBConstruct 1–163； UniProt 1–163 Author chain CD； PDBConstruct 1–163； UniProt 1–163 Author chain Cd； PDBConstruct 1–163； UniProt 1–163 Author chain DD； PDBConstruct 1–163； UniProt 1–163 Author chain Dd； PDBConstruct 1–163； UniProt 1–163 Author chain ED； PDBConstruct 1–163； UniProt 1–163 Author chain Ed； PDBConstruct 1–163； UniProt 1–163 Author chain FD； PDBConstruct 1–163； UniProt 1–163 Author chain Fd； PDBConstruct 1–163； UniProt 1–163 Author chain GD； PDBConstruct 1–163； UniProt 1–163 Author chain Gd； PDBConstruct 1–163； UniProt 1–163 Author chain HD； PDBConstruct 1–163； UniProt 1–163 Author chain Hd； PDBConstruct 1–163； UniProt 1–163 Author chain ID； PDBConstruct 1–163； UniProt 1–163 Author chain Id； PDBConstruct 1–163； UniProt 1–163 Author chain JD； PDBConstruct 1–163； UniProt 1–163 Author chain Jd； PDBConstruct 1–163； UniProt 1–163 Author chain KD； PDBConstruct 1–163； UniProt 1–163 Author chain Kd； PDBConstruct 1–163； UniProt 1–163 Author chain LD； PDBConstruct 1–163； UniProt 1–163 Author chain Ld； PDBConstruct 1–163； UniProt 1–163 Author chain MD； PDBConstruct 1–163； UniProt 1–163 Author chain Md； PDBConstruct 1–163； UniProt 1–163

Type IV secretion protein IcmK

OrganismNot specified

UniProt A0A2S6FBG9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 205	IcmE protein × 34 （O53087） DotC × 13 （O52184） DotF × 31 （O54615） DotD × 26 （O52183） Inner membrane lipoprotein YiaD × 13 （O53086） Outer membrane protein, OmpA family protein × 13 （Q5ZXS4） DUF2807 domain-containing protein × 13 （A0A2S6F0F8） Neurogenic locus notch × 13 （A0A2S6FAR3） Unknown protein fragment × 13 Unknown protein fragment × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2S6FBG9_LEGPN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain AH； PDBConstruct 1–361； UniProt 1–361 Author chain BH； PDBConstruct 1–361； UniProt 1–361 Author chain CH； PDBConstruct 1–361； UniProt 1–361 Author chain DH； PDBConstruct 1–361； UniProt 1–361 Author chain EH； PDBConstruct 1–361； UniProt 1–361 Author chain FH； PDBConstruct 1–361； UniProt 1–361 Author chain GH； PDBConstruct 1–361； UniProt 1–361 Author chain HH； PDBConstruct 1–361； UniProt 1–361 Author chain IH； PDBConstruct 1–361； UniProt 1–361 Author chain JH； PDBConstruct 1–361； UniProt 1–361 Author chain KH； PDBConstruct 1–361； UniProt 1–361 Author chain LH； PDBConstruct 1–361； UniProt 1–361 Author chain MH； PDBConstruct 1–361； UniProt 1–361 Author chain VH； PDBConstruct 1–361； UniProt 1–361 Author chain WH； PDBConstruct 1–361； UniProt 1–361 Author chain XH； PDBConstruct 1–361； UniProt 1–361 Author chain YH； PDBConstruct 1–361； UniProt 1–361 Author chain ZH； PDBConstruct 1–361； UniProt 1–361

Inner membrane lipoprotein YiaD

OrganismNot specified

UniProt O53086

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 205	IcmE protein × 34 （O53087） DotC × 13 （O52184） DotF × 31 （O54615） DotD × 26 （O52183） Type IV secretion protein IcmK × 18 （A0A2S6FBG9） Outer membrane protein, OmpA family protein × 13 （Q5ZXS4） DUF2807 domain-containing protein × 13 （A0A2S6F0F8） Neurogenic locus notch × 13 （A0A2S6FAR3） Unknown protein fragment × 13 Unknown protein fragment × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	O53086_LEGPN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain AK； PDBConstruct 1–189； UniProt 1–189 Author chain BK； PDBConstruct 1–189； UniProt 1–189 Author chain CK； PDBConstruct 1–189； UniProt 1–189 Author chain DK； PDBConstruct 1–189； UniProt 1–189 Author chain EK； PDBConstruct 1–189； UniProt 1–189 Author chain FK； PDBConstruct 1–189； UniProt 1–189 Author chain GK； PDBConstruct 1–189； UniProt 1–189 Author chain HK； PDBConstruct 1–189； UniProt 1–189 Author chain IK； PDBConstruct 1–189； UniProt 1–189 Author chain JK； PDBConstruct 1–189； UniProt 1–189 Author chain KK； PDBConstruct 1–189； UniProt 1–189 Author chain LK； PDBConstruct 1–189； UniProt 1–189 Author chain MK； PDBConstruct 1–189； UniProt 1–189

Outer membrane protein, OmpA family protein

OrganismNot specified

UniProt Q5ZXS4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 205	IcmE protein × 34 （O53087） DotC × 13 （O52184） DotF × 31 （O54615） DotD × 26 （O52183） Type IV secretion protein IcmK × 18 （A0A2S6FBG9） Inner membrane lipoprotein YiaD × 13 （O53086） DUF2807 domain-containing protein × 13 （A0A2S6F0F8） Neurogenic locus notch × 13 （A0A2S6FAR3） Unknown protein fragment × 13 Unknown protein fragment × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q5ZXS4_LEGPH
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain AL； PDBConstruct 1–249； UniProt 1–249 Author chain BL； PDBConstruct 1–249； UniProt 1–249 Author chain CL； PDBConstruct 1–249； UniProt 1–249 Author chain DL； PDBConstruct 1–249； UniProt 1–249 Author chain EL； PDBConstruct 1–249； UniProt 1–249 Author chain FL； PDBConstruct 1–249； UniProt 1–249 Author chain GL； PDBConstruct 1–249； UniProt 1–249 Author chain HL； PDBConstruct 1–249； UniProt 1–249 Author chain IL； PDBConstruct 1–249； UniProt 1–249 Author chain JL； PDBConstruct 1–249； UniProt 1–249 Author chain KL； PDBConstruct 1–249； UniProt 1–249 Author chain LL； PDBConstruct 1–249； UniProt 1–249 Author chain ML； PDBConstruct 1–249； UniProt 1–249

DUF2807 domain-containing protein

OrganismNot specified

UniProt A0A2S6F0F8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 205	IcmE protein × 34 （O53087） DotC × 13 （O52184） DotF × 31 （O54615） DotD × 26 （O52183） Type IV secretion protein IcmK × 18 （A0A2S6FBG9） Inner membrane lipoprotein YiaD × 13 （O53086） Outer membrane protein, OmpA family protein × 13 （Q5ZXS4） Neurogenic locus notch × 13 （A0A2S6FAR3） Unknown protein fragment × 13 Unknown protein fragment × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2S6F0F8_LEGPN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain AM； PDBConstruct 1–320； UniProt 1–320 Author chain BM； PDBConstruct 1–320； UniProt 1–320 Author chain CM； PDBConstruct 1–320； UniProt 1–320 Author chain DM； PDBConstruct 1–320； UniProt 1–320 Author chain EM； PDBConstruct 1–320； UniProt 1–320 Author chain FM； PDBConstruct 1–320； UniProt 1–320 Author chain GM； PDBConstruct 1–320； UniProt 1–320 Author chain HM； PDBConstruct 1–320； UniProt 1–320 Author chain IM； PDBConstruct 1–320； UniProt 1–320 Author chain JM； PDBConstruct 1–320； UniProt 1–320 Author chain KM； PDBConstruct 1–320； UniProt 1–320 Author chain LM； PDBConstruct 1–320； UniProt 1–320 Author chain MM； PDBConstruct 1–320； UniProt 1–320

Neurogenic locus notch

OrganismNot specified

UniProt A0A2S6FAR3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 205	IcmE protein × 34 （O53087） DotC × 13 （O52184） DotF × 31 （O54615） DotD × 26 （O52183） Type IV secretion protein IcmK × 18 （A0A2S6FBG9） Inner membrane lipoprotein YiaD × 13 （O53086） Outer membrane protein, OmpA family protein × 13 （Q5ZXS4） DUF2807 domain-containing protein × 13 （A0A2S6F0F8） Unknown protein fragment × 13 Unknown protein fragment × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2S6FAR3_LEGPN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain AN； PDBConstruct 1–124； UniProt 1–124 Author chain BN； PDBConstruct 1–124； UniProt 1–124 Author chain CN； PDBConstruct 1–124； UniProt 1–124 Author chain DN； PDBConstruct 1–124； UniProt 1–124 Author chain EN； PDBConstruct 1–124； UniProt 1–124 Author chain FN； PDBConstruct 1–124； UniProt 1–124 Author chain GN； PDBConstruct 1–124； UniProt 1–124 Author chain HN； PDBConstruct 1–124； UniProt 1–124 Author chain IN； PDBConstruct 1–124； UniProt 1–124 Author chain JN； PDBConstruct 1–124； UniProt 1–124 Author chain KN； PDBConstruct 1–124； UniProt 1–124 Author chain LN； PDBConstruct 1–124； UniProt 1–124 Author chain MN； PDBConstruct 1–124； UniProt 1–124

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7muq
Deposition date deposition_date	2021-05-14
Structure title title	Reconstruction of the Legionella pneumophila Dot/Icm T4SS 3DVA Map 1
Keywords keywords	Dot/Icm, Secretion, T4SS, TRANSLOCASE; TRANSLOCASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7muq__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7muq__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7muq__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	121.10 Å
Total Rg	121.10 Å
Atom count	192370
Residues	25121
Excluded volume	3434100 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7muq__assembly_1__model_1`	205-meric （205）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (11)

Entity 1 Entity 1 polymer

Description description	IcmE protein
Molecular weight formula_weight	107911.9 kDa
Source method src_method	nat
Copy count entity_count	34

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AG,Gg,Hg,BG,Bg,Ig,Jg,CG,Kg,Lg,DG,Cg,Mg,Ag,VG,WG,EG,XG,YG,ZG,FG,Dg,GG,Eg,Fg,HG,IG,JG,KG,LG,MG,NG,OG,PG
Atom count atom_count	192370

MASKKENLKSLFSNTRTRVIIIFTAALLIIAVVIGFFKIRGATTGSIAAAEVSTVPGGIQSIPGVLDPTAQYAKLQEEQNITQAQVAEKTGGSAIPTIIRTQALGEGVGVIGSQSGVGFAALAQEELGGPQRSLWIQELQDGSCSKSVITKVVNQGAQLTDLKAACSCVQLKDSGYGLQELEQVCECKELKSAGYNARQLKEAGYSAGRLRNCGFDACELRNAGFTAQEMKDGGFSDGELKGAGFSDAEIAKASGLPDGITADDVRKAGCGAAALAKLRQAGVSASAIRKISGCTAEQLKAAGYTAKELKDAGFSAADLRRAGFSAAELKDAGFTARDLLNAGFTPADLAKAGFSDAQIKAAQAELPPGITPQDVKNAGCDVEALKKEREAGVSAALIRQYAGCSAQALKAAGFTDADLANAGFTPAQISAATPLSDAEIKAAGCDPDKLKKLFSAGVSAKRIKELNGCSAEALKAAGYDAQSLLAAGFTPQELLAAGFTPKQLEDAGLNPVSIIADGRVADCSVESLKKARAAGVSALTIKQTLGCSAAALKAAGYTAKELKDAGFTAAELKAAGFSAKELKDAGFTAKELRDAGFSAQELKDVGFSAKDLKDAGFSAAELKAAGFTAAQLKAAGFSAKDLKDAGFSAAELKAAGFSAKELKDAGFSASDLKNAGFSAKELKDAGFSASDLKSAGFSASELKNAGYSADELKKAGYTSAELRNAGFSPQESAVAGLQGPDLQQLDSSITGIPSIPGATPRPTTSDAASSAEQLQAILQKQNEQLAEQKYQQEIQQRTSDMLTAATQLVQDWKQVETQVYTEGTEETKTSGGESAVPGTGTGTGSNNQPVDQGAVSAQNQAIIKTGDIMFAVLDTSVNSDEPGPILATIVTGKLKGSKLIGSFNLPSNADKMVITFNTMSIPGAEKTISISAYAIDPNTARTALASRTNHHYLMRYGSLFASSFLQGFGNAFQSANTTITIGGTGGGNNITVANGVGRSTLENAVIGLATVGKAWSQQAQQLFNTPTTVEVYSGTGLGILFTQDVTTI

Entity 2 Entity 2 polymer

Description description	DotC
Molecular weight formula_weight	34162.4 kDa
Source method src_method	nat
Copy count entity_count	13

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BC,EC,CC,DC,FC,GC,IC,JC,KC,MC,HC,LC,AC

MRKFILSLSILLSALLVACSSRNHYGDTGSLAGLQAMADSKYTRAQKKQKMGKIREMALKETALSVGAQAGLAWRAKIIDEQLNKQARNLDAIYDFNSLVLEHNILPPVLLEGRNTLNLADAQSIRISDRTYKVAKQAHFITTPPTWRQYLWMDYVKPEAPNVTLLPKTKAEKEIWCIYTERGWKNGIDQANTILEENIARIKEDFGGMILYRKLLAMNMVSPPYVSHTDLGVTGDGSEIHIDDRVLRITALPELNVNSAEWRAAVAKDENALERFKNMEKLANQAKIVITNKSWQPIIAPVS

Entity 3 Entity 3 polymer

Description description	DotF
Molecular weight formula_weight	29730.0 kDa
Source method src_method	nat
Copy count entity_count	31

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AF,GF,Gf,HF,Hf,IF,If,JF,Jf,KF,Kf,LF,Lf,MF,Mf,VF,WF,XF,YF,Df,ZF,Af,BF,CF,Bf,Cf,DF,EF,Ef,FF,Ff

MMAEHDQNNDEYKFAELDSYDMDQAGESDLDSEASYQSGKEGLTKKKDIKRNALIAIGAVVFIMVMYKIIGWMFFSDKSSQVTSKPAIPPVTQVATPQPVQTIPTTTPIQQVQPTTIIEDDPDLKKKVSAIEMTQQSLRSEVNALSEQINAVNNNIKNLNAQIVNLNQIIGNMSNQIARQSEVINVLMARTTPKKVVKVSRPIVQARIIYYIQAVIPGRAWLIGSNGSTLTVREGSKIPGYGMVKLIDSLQGRILTSSGQVIKFSQEDS

Entity 4 Entity 4 polymer

Description description	DotD
Molecular weight formula_weight	17860.7 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	GD,Gd,HD,Hd,ID,Dd,Id,JD,Jd,KD,Kd,LD,Ld,MD,Md,CD,Ad,BD,Bd,AD,Cd,DD,ED,Ed,FD,Fd

MNNNKIVIMFIFSALLAGCAGTMKFKKPPINNPSDDATIKLAEAAVSVSDSMLEMAKVEKVITPPSKDNTLTIPNAYNLQARASVDWSGPIEELTARIAKAAHFRFRVLGKSPSVPVLISISTKDESLAEILRDIDYQAGKKASIHVYPNSQVVELRYAKIYS

Entity 5 Entity 5 polymer

Description description	Type IV secretion protein IcmK
Molecular weight formula_weight	38958.9 kDa
Source method src_method	nat
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	GH,HH,IH,JH,AH,KH,LH,MH,VH,WH,XH,YH,ZH,BH,CH,DH,EH,FH

MMKKYDQLCKYCLVIGLTFSMSCSIYAADQSDDAQQALQQLRMLQQKLSQNPSPDAQSGAGDGGDNAASDSTQQPNQSGQANAPAANQTATAGGDGQIISQDDAEVIDKKAFKDMTRNLYPLNPEQVVKLKQIYETSEYAKAATPGTPPKPTATSQFVNLSPGSTPPVIRLSQGFVSSLVFLDSTGAPWPIAAYDLGDPSSFNIQWDKTSNTLMIQATKLYNYGNLAVRLRGLNTPVMLTLIPGQKAVDYRVDLRVQGYGPNAKSMPTEEGIPPSANDLLLHVLEGVPPPGSRRLVVSGGDARAWLSNEKMYVRTNLTILSPGWLASMTSADGTHAYEMQKSPVLLVSWHGKVMQLKVEGL

Entity 6 Entity 6 polymer

Description description	Inner membrane lipoprotein YiaD
Molecular weight formula_weight	21096.5 kDa
Source method src_method	nat
Copy count entity_count	13

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	GK,HK,IK,JK,KK,LK,AK,MK,BK,CK,DK,EK,FK

MRSLRTNYIYVLFKTTGLLFLLLLSACNRSGYIPENEVPKLPCRVDGACDATIIKMMTDLNKKGIKVASVGQNYLISIPASALFADQSPRLNWASYSLLNEIAAFLKQFRKIAITVTSYSSKYVSVKRERALTLARSRVVSEYLWSQGVDSRIIFTQGLGSDKPITSYTLGGDRSPNARVEITFRRAVA

Entity 7 Entity 7 polymer

Description description	Outer membrane protein, OmpA family protein
Molecular weight formula_weight	27582.0 kDa
Source method src_method	nat
Copy count entity_count	13

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	GL,HL,IL,JL,KL,LL,ML,AL,BL,CL,DL,EL,FL

MRNLMRCLIMIKSLIKGVDMSRKLAKTRILGYGLMICFLAGCFHPPYNNFQPDRRAVKRVGVDTGIGAVAGAIASGTASGTLIGAAAGGTVGLVASIYRDSKRKIIRDLQKQDIQYVEYGDTRTLIIPTDKYFMFSSPRLNEICYPGLNNVIRLLNFYPQSTIYVAGFTDNVGSRSHKRKLSQAQAETMMTFLWANGIAAKRLKAEGYGDKNAISDNAIIHGSAQNRRIEIQWFTSPAQPPQPQMAYVK

Entity 8 Entity 8 polymer

Description description	DUF2807 domain-containing protein
Molecular weight formula_weight	36095.4 kDa
Source method src_method	nat
Copy count entity_count	13

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	GM,HM,IM,JM,KM,LM,MM,AM,BM,CM,DM,EM,FM

MLKRCYLLILLMFVLASCAHHKPQTPPAEVKKQGTSSTRQFRQVSSFNQIVVQGRLNVNLHTGYNKPEVMLRGDPRDLVQVRTIVKQNTLYVSLGQGYPDYGAVTVDIKTKFLNRFRYEGAGVVTGNNLRTSYLDLYLANEGTTRLAGNIGLQKLEAVGNGVTQINGVSSRNLQIVLKGDPKVLISGFVNLRQLDMYGKGTLSLYWIKSDTLTIRAKKAAKIQLAGIVNRLDVELWDFAQFKGKYLRAQRSFVKTHDKSVAEISAVNHQSSLATDASDIYYYNLSKTRADFMAFNGSVLDMREWGQSDLKDFDRYNKQFP

Entity 9 Entity 9 polymer

Description description	Neurogenic locus notch
Molecular weight formula_weight	13598.9 kDa
Source method src_method	nat
Copy count entity_count	13

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	GN,HN,IN,JN,KN,LN,MN,AN,BN,CN,DN,EN,FN

MLFLKIKTNQRTTMNILKPKAFLLASVFVLSISPAFAADGCCSKMGGINYCDSSAGRLVCNNGFYSTCYCTRHAVMDLQFLMGCCLWHGGVYPQLNSSGLVVCNDGYVSEECSLQKPVEQISVY

Entity 10 Entity 10 polymer

Description description	Unknown protein fragment
Molecular weight formula_weight	784.0 kDa
Source method src_method	nat
Copy count entity_count	13

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	GU,HU,IU,JU,KU,LU,MU,AU,BU,CU,DU,EU,FU

XXXXXXXXX

Entity 11 Entity 11 polymer

Description description	Unknown protein fragment
Molecular weight formula_weight	4103.0 kDa
Source method src_method	nat
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	GX,DX,HX,IX,JX,KX,LX,MX,VX,WX,XX,YX,ZX,AX,BX,CX,EX,FX

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	79720

Reconstruction of the Legionella pneumophila Dot/Icm T4SS 3DVA Map 1

1. Protein Identity and Related Structures Protein Identity & Related Structures

IcmE protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DotC

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DotF

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DotD

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Type IV secretion protein IcmK

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Inner membrane lipoprotein YiaD

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Outer membrane protein, OmpA family protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DUF2807 domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Neurogenic locus notch

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7muq__assembly_1__model_1

7muq__assembly_1__model_1 | I(q)

7muq__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment