7nao

Human PA28-20S proteasome complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome subunit alpha type-2

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072） Proteasome activator complex subunit 2 × 4 （Q9UL46） Proteasome activator complex subunit 1 × 3 （Q06323）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA2_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–234； UniProt 1–234 Author chain O； PDBConstruct 1–234； UniProt 1–234

Proteasome subunit alpha type-4

OrganismNot specified

UniProt P25789

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072） Proteasome activator complex subunit 2 × 4 （Q9UL46） Proteasome activator complex subunit 1 × 3 （Q06323）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA4_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–261； UniProt 1–261 Author chain P； PDBConstruct 1–261； UniProt 1–261

Proteasome subunit alpha type-7

OrganismNot specified

UniProt O14818

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072） Proteasome activator complex subunit 2 × 4 （Q9UL46） Proteasome activator complex subunit 1 × 3 （Q06323）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA7_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–248； UniProt 1–248 Author chain Q； PDBConstruct 1–248； UniProt 1–248

Proteasome subunit alpha type-5

OrganismNot specified

UniProt P28066

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072） Proteasome activator complex subunit 2 × 4 （Q9UL46） Proteasome activator complex subunit 1 × 3 （Q06323）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA5_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–241； UniProt 1–241 Author chain R； PDBConstruct 1–241； UniProt 1–241

Proteasome subunit alpha type-1

OrganismNot specified

UniProt P25786

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072） Proteasome activator complex subunit 2 × 4 （Q9UL46） Proteasome activator complex subunit 1 × 3 （Q06323）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA1_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–263； UniProt 1–263 Author chain S； PDBConstruct 1–263； UniProt 1–263

Proteasome subunit alpha type-3

OrganismNot specified

UniProt P25788

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072） Proteasome activator complex subunit 2 × 4 （Q9UL46） Proteasome activator complex subunit 1 × 3 （Q06323）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA3_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–255； UniProt 1–255 Author chain T； PDBConstruct 1–255； UniProt 1–255

Proteasome subunit alpha type-6

OrganismNot specified

UniProt P60900

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072） Proteasome activator complex subunit 2 × 4 （Q9UL46） Proteasome activator complex subunit 1 × 3 （Q06323）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA6_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–246； UniProt 1–246 Author chain U； PDBConstruct 1–246； UniProt 1–246

Proteasome subunit beta type-7

OrganismNot specified

UniProt Q99436

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072） Proteasome activator complex subunit 2 × 4 （Q9UL46） Proteasome activator complex subunit 1 × 3 （Q06323）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB7_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–277； UniProt 1–277 Author chain V； PDBConstruct 1–277； UniProt 1–277

Proteasome subunit beta type-3

OrganismNot specified

UniProt P49720

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072） Proteasome activator complex subunit 2 × 4 （Q9UL46） Proteasome activator complex subunit 1 × 3 （Q06323）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB3_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–205； UniProt 1–205 Author chain W； PDBConstruct 1–205； UniProt 1–205

Proteasome subunit beta type-2

OrganismNot specified

UniProt P49721

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072） Proteasome activator complex subunit 2 × 4 （Q9UL46） Proteasome activator complex subunit 1 × 3 （Q06323）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB2_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–201； UniProt 1–201 Author chain X； PDBConstruct 1–201； UniProt 1–201

Proteasome subunit beta type-5

OrganismNot specified

UniProt P28074

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072） Proteasome activator complex subunit 2 × 4 （Q9UL46） Proteasome activator complex subunit 1 × 3 （Q06323）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB5_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–263； UniProt 1–263 Author chain Y； PDBConstruct 1–263； UniProt 1–263

Proteasome subunit beta type-1

OrganismNot specified

UniProt P20618

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072） Proteasome activator complex subunit 2 × 4 （Q9UL46） Proteasome activator complex subunit 1 × 3 （Q06323）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB1_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–241； UniProt 1–241 Author chain Z； PDBConstruct 1–241； UniProt 1–241

Proteasome subunit beta type-4

OrganismNot specified

UniProt P28070

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-6 × 2 （P28072） Proteasome activator complex subunit 2 × 4 （Q9UL46） Proteasome activator complex subunit 1 × 3 （Q06323）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB4_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain M； PDBConstruct 1–264； UniProt 1–264 Author chain a； PDBConstruct 1–264； UniProt 1–264

Proteasome subunit beta type-6

OrganismNot specified

UniProt P28072

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome activator complex subunit 2 × 4 （Q9UL46） Proteasome activator complex subunit 1 × 3 （Q06323）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB6_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain N； PDBConstruct 1–239； UniProt 1–239 Author chain b； PDBConstruct 1–239； UniProt 1–239

Proteasome activator complex subunit 2

OrganismNot specified

UniProt Q9UL46

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072） Proteasome activator complex subunit 1 × 3 （Q06323）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSME2_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain d； PDBConstruct 1–239； UniProt 1–239 Author chain f； PDBConstruct 1–239； UniProt 1–239 Author chain h； PDBConstruct 1–239； UniProt 1–239 Author chain i； PDBConstruct 1–239； UniProt 1–239

Proteasome activator complex subunit 1

OrganismNot specified

UniProt Q06323

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072） Proteasome activator complex subunit 2 × 4 （Q9UL46）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSME1_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain c； PDBConstruct 1–249； UniProt 1–249 Author chain e； PDBConstruct 1–249； UniProt 1–249 Author chain g； PDBConstruct 1–249； UniProt 1–249

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7nao
Deposition date deposition_date	2021-06-22
Structure title title	Human PA28-20S proteasome complex
Keywords keywords	proteasome, 20S, PA28, HYDROLASE; HYDROLASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7nao__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7nao__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7nao__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	69.63 Å
Rg (electron density)	70.04 Å
Total Rg	69.91 Å
Atom count	58083
Residues	7741
Excluded volume	1040800 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7nao__assembly_1__model_1`	35-meric （35）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (16)

Entity 1 Entity 1 polymer

Description description	Proteasome subunit alpha type-2
Molecular weight formula_weight	25927.5 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,O
Atom count atom_count	58083

MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA

Entity 2 Entity 2 polymer

Description description	Proteasome subunit alpha type-4
Molecular weight formula_weight	29525.8 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,P

MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKHEEEEAKAEREKKEKEQKEKDK

Entity 3 Entity 3 polymer

Description description	Proteasome subunit alpha type-7
Molecular weight formula_weight	27929.9 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,Q

MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS

Entity 4 Entity 4 polymer

Description description	Proteasome subunit alpha type-5
Molecular weight formula_weight	26436.0 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,R

MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI

Entity 5 Entity 5 polymer

Description description	Proteasome subunit alpha type-1
Molecular weight formula_weight	29595.6 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,S

MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH

Entity 6 Entity 6 polymer

Description description	Proteasome subunit alpha type-3
Molecular weight formula_weight	28469.3 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,T

MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM

Entity 7 Entity 7 polymer

Description description	Proteasome subunit alpha type-6
Molecular weight formula_weight	27432.5 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,U

MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD

Entity 8 Entity 8 polymer

Description description	Proteasome subunit beta type-7
Molecular weight formula_weight	30000.4 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,V

MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS

Entity 9 Entity 9 polymer

Description description	Proteasome subunit beta type-3
Molecular weight formula_weight	22972.9 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,W

MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD

Entity 10 Entity 10 polymer

Description description	Proteasome subunit beta type-2
Molecular weight formula_weight	22864.3 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,X

MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS

Entity 11 Entity 11 polymer

Description description	Proteasome subunit beta type-5
Molecular weight formula_weight	28510.2 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,Y

MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKYSGSTP

Entity 12 Entity 12 polymer

Description description	Proteasome subunit beta type-1
Molecular weight formula_weight	26522.4 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,Z

MLSSTAMYSAPGRDLGMEPHRAAGPLQLRFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD

Entity 13 Entity 13 polymer

Description description	Proteasome subunit beta type-4
Molecular weight formula_weight	29231.2 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,a

MEAFLGSRSGLWAGGPAPGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE

Entity 14 Entity 14 polymer

Description description	Proteasome subunit beta type-6
Molecular weight formula_weight	25377.7 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N,b

MAATLLAARGAGPAPAWGPEAFTPDWESREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKEECLQFTANALALAMERDGSSGGVIRLAAIAESGVERQVLLGDQIPKFAVATLPPA

Entity 15 Entity 15 polymer

Description description	Proteasome activator complex subunit 2
Molecular weight formula_weight	27439.6 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d,f,h,i

MAKPCGVRLSGEARKQVEVFRQNLFQEAEEFLYRFLPQKIIYLNQLLQEDSLNVADLTSLRAPLDIPIPDPPPKDDEMETDKQEKKEVHKCGFLPGNEKVLSLLALVKPEVWTLKEKCILVITWIQHLIPKIEDGNDFGVAIQEKVLERVNAVKTKVEAFQTTISKYFSERGDAVAKASKETHVMDYRALVHERDEAAYGELRAMVLDLRAFYAELYHIISSNLEKIVNPKGEEKPSMY

Entity 16 Entity 16 polymer

Description description	Proteasome activator complex subunit 1
Molecular weight formula_weight	28768.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c,e,g

MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY

▼

6. Fold Classification (SCOP + CATH) 10 domains

CATH v4.4 (10 domains)

Domain ID domain_id	7naoA01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	7naoB01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	7naoC01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	7naoD01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	7naoH01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	7naoO01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	7naoP01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	7naoQ01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	7naoR01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	7naoV01
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	135937

Human PA28-20S proteasome complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome subunit alpha type-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta type-7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta type-3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta type-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer