SAXSdb — 7ndy

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Barrier-to-autointegration factor, N-terminally processed

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain A； UniProt 2–89 Chain B； UniProt 2–89	Non-standard monomer：Yes (specific site not provided by mmCIF)	Emerin × 1 （P50402） EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；Hepes Sodium salt 0.1 M pH 7.5 PEG 600 25% W/V	Resolution 1.44 Å R-free 0.225

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7NDY	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1CI4 THE CRYSTAL STRUCTURE OF HUMAN BARRIER-TO-AUTOINTEGRATION FACTOR (BAF) Deposited 1999-04-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–89（89 aa） Chain B 1–89（89 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；DIALYSIS OF PROTEIN AT 8.3 MG/ML IN 20MM TRIS HCL AT PH7.0, 10%(W/V) GLYCEROL, 150MM NACL, 10MM DTT, AND 0.1MM EDTA AGAINST 20MM IMIDAZOLE AT PH 6.5, 80MM NACL, AND 10MM DTT. DIALYSIS DONE AT ROOM TEMPERATURE.(ALL CONCENTRATIONS ARE IN MILLI-MOLAR)	Resolution 1.90 Å R-free 0.262
1QCK SOLUTION STRUCTURE OF HUMAN BARRIER-TO-AUTOINTEGRATION FACTOR BAF, NMR, REGULARIZED MEAN STRUCTURE PLUS 20 INDIVIDUAL SIMULATED ANNEALING STRUCTURES Deposited 1999-05-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–89（89 aa） Chain B 1–89（89 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；313 K	Resolution not provided
2BZF Structural basis for DNA bridging by barrier-to-autointegration factor (BAF) Deposited 2005-08-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: hexameric	Chain A 1–89（89 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.4；pH 7.40	Resolution 2.87 Å R-free 0.268
2EZX SOLUTION STRUCTURE OF HUMAN BARRIER-TO-AUTOINTEGRATION FACTOR BAF, NMR, REGULARIZED MEAN STRUCTURE Deposited 1998-07-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–89（89 aa） Chain B 1–89（89 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；313 K	Resolution not provided
2EZY SOLUTION STRUCTURE OF HUMAN BARRIER-TO-AUTOINTEGRATION FACTOR BAF, NMR, ENSEMBLE OF 20 SIMULATED ANNEALING STRUCTURES Deposited 1998-07-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–89（89 aa） Chain B 1–89（89 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；313 K	Resolution not provided
2EZZ SOLUTION STRUCTURE OF HUMAN BARRIER-TO-AUTOINTEGRATION FACTOR BAF NMR, ENSEMBLE OF 20 SIMULATED ANNEALING STRUCTURES Deposited 1998-07-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–89（89 aa） Chain B 1–89（89 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；313 K	Resolution not provided
2ODG Complex of barrier-to-autointegration factor and LEM-domain of emerin Deposited 2006-12-22	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–89（89 aa） Fragment：RESIDUES 1-89 Chain B 1–89（89 aa） Fragment：RESIDUES 1-89	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；303 K；Ionic strength (raw mmCIF value) 50 mM POTASSIUM PHOSPHATE 200 mM NACL	Resolution not provided
6GHD Structural analysis of the ternary complex between lamin A/C, BAF and emerin identifies an interface disrupted in autosomal recessive progeroid diseases Deposited 2018-05-07	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 2–89（88 aa） Chain E 2–89（88 aa）	Not recorded	SO4 SULFATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；25% PEG3.350, 20mM Tris-BispH5.5, 30mM NaCl, 0.2M NH4SO4	Resolution 2.10 Å R-free 0.247
6GHD Structural analysis of the ternary complex between lamin A/C, BAF and emerin identifies an interface disrupted in autosomal recessive progeroid diseases Deposited 2018-05-07	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 2–89（88 aa） Chain C 2–89（88 aa）	Not recorded	SO4 SULFATE ION × 3 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；25% PEG3.350, 20mM Tris-BispH5.5, 30mM NaCl, 0.2M NH4SO4	Resolution 2.10 Å R-free 0.247
6UNT Barrier-to-autointegration factor soaked in DMSO: 1 of 14 in MSCS set Deposited 2019-10-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–89（89 aa） Chain B 1–89（89 aa）	Not recorded	EOH ETHANOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277.15 K；80 mM Tris pH 8.5, 16% Ethanol, 10% PEG-1450	Resolution 1.75 Å R-free 0.223
6URE Barrier-to-autointegration factor Aqueous: 1 of 14 in MSCS set Deposited 2019-10-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–89（89 aa） Chain B 1–89（89 aa）	Not recorded	EOH ETHANOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277.15 K；80 mM Tris pH 8.5, 16% Ethanol, 10% PEG-1450	Resolution 1.65 Å R-free 0.202
6URJ Barrier-to-autointegration factor soaked in Acetone: 1 of 14 in MSCS set Deposited 2019-10-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–89（89 aa） Chain B 1–89（89 aa）	Not recorded	EOH ETHANOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277.15 K；80 mM Tris pH 8.5, 16% Ethanol, 10% PEG-1450	Resolution 1.65 Å R-free 0.192
6URK Barrier-to-autointegration factor soaked in Glycerol: 1 of 14 in MSCS set Deposited 2019-10-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–89（89 aa） Chain B 1–89（89 aa）	Not recorded	EOH ETHANOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277.15 K；80 mM Tris pH 8.5, 16% Ethanol, 10% PEG-1450	Resolution 1.86 Å R-free 0.226
6URL Barrier-to-autointegration factor soaked in isopropanol: 1 of 14 in MSCS set Deposited 2019-10-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–89（89 aa） Chain B 1–89（89 aa）	Not recorded	EOH ETHANOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277.15 K；80 mM Tris pH 8.5, 16% Ethanol, 10% PEG-1450	Resolution 1.72 Å R-free 0.201
6URN Barrier-to-autointegration factor t-butanol: 1 of 14 in MSCS set Deposited 2019-10-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–89（89 aa） Chain B 1–89（89 aa）	Not recorded	EOH ETHANOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277.15 K；80 mM Tris pH 8.5, 16% Ethanol, 10% PEG-1450	Resolution 1.68 Å R-free 0.204
6URR Barrier-to-autointegration factor soaked in Dioxane: 1 of 14 in MSCS set Deposited 2019-10-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–89（89 aa） Chain B 1–89（89 aa）	Not recorded	EOH ETHANOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277.15 K；80 mM Tris pH 8.5, 16% Ethanol, 10% PEG-1450	Resolution 1.80 Å R-free 0.230
6URZ Barrier-to-autointegration factor soaked in methanol: 1 of 14 in MSCS set Deposited 2019-10-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–89（89 aa） Chain B 1–89（89 aa）	Not recorded	EOH ETHANOL × 2 MOH METHANOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277.15 K；80 mM Tris pH 8.5, 16% Ethanol, 10% PEG-1450	Resolution 1.65 Å R-free 0.201
6US0 Barrier-to-autointegration factor soaked in R,S,R-bisfuranol (RSR): 1 of 14 in MSCS set Deposited 2019-10-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–89（89 aa） Chain B 1–89（89 aa）	Not recorded	EOH ETHANOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277.15 K；80 mM Tris pH 8.5, 16% Ethanol, 10% PEG-1450	Resolution 1.65 Å R-free 0.201
6US1 Barrier-to-autointegration factor soaked in isobutanol: 1 of 14 in MSCS set Deposited 2019-10-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–89（89 aa） Chain B 1–89（89 aa）	Not recorded	EOH ETHANOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277.15 K；80 mM Tris pH 8.5, 16% Ethanol, 10% PEG-1450	Resolution 1.65 Å R-free 0.199
6US7 Barrier-to-autointegration factor soaked in TMAO: 1 of 14 in MSCS set Deposited 2019-10-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–89（89 aa） Chain B 1–89（89 aa）	Not recorded	EOH ETHANOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277.15 K；80 mM Tris pH 8.5, 16% Ethanol, 10% PEG-1450	Resolution 1.65 Å R-free 0.198
6USB Barrier-to-autointegration factor soaked in urea: 1 of 14 in MSCS set Deposited 2019-10-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–89（89 aa） Chain B 1–89（89 aa）	Not recorded	EOH ETHANOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277.15 K；80 mM Tris pH 8.5, 16% Ethanol, 10% PEG-1450	Resolution 1.68 Å R-free 0.210
6USD Barrier-to-autointegration factor soaked in ethanol: 1 of 14 in MSCS set Deposited 2019-10-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–89（89 aa） Chain B 1–89（89 aa）	Not recorded	EOH ETHANOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277.15 K；80 mM Tris pH 8.5, 16% Ethanol, 10% PEG-1450	Resolution 1.65 Å R-free 0.202
6USI Barrier-to-autointegration factor soaked in 1,6-hexanediol: 1 of 14 in MSCS set Deposited 2019-10-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–89（89 aa） Chain B 1–89（89 aa）	Not recorded	EOH ETHANOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277.15 K；80 mM Tris pH 8.5, 16% Ethanol, 10% PEG-1450	Resolution 1.65 Å R-free 0.208
7ABM X-ray structure of phosphorylated Barrier-to-autointegration factor (BAF) Deposited 2020-09-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 3–88（86 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	CS CESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；pBAF was crystallized by the hanging drop method against 0.2 M sodium fluoride, 20% w/v PEG 3350	Resolution 3.00 Å R-free 0.326
7Z21 BAF A12T bound to the lamin A/C Ig-fold domain Deposited 2022-02-25	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 2–89（88 aa） Chain C 2–89（88 aa）	Mutation：A12T Mutation：A12T	CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；293 K；3 M ammonium sulfate 0.1 M bicine pH 9	Resolution 1.63 Å R-free 0.300
7Z21 BAF A12T bound to the lamin A/C Ig-fold domain Deposited 2022-02-25	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 2–89（88 aa） Chain D 2–89（88 aa）	Mutation：A12T Mutation：A12T	CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；293 K；3 M ammonium sulfate 0.1 M bicine pH 9	Resolution 1.63 Å R-free 0.300
9J8M Cryo-EM structure of BAF-Lamin A/C IgF-nucleosome complex (High mobility complex) Deposited 2024-08-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 11 PDB declaration: tridecameric	Chain K 1–89（89 aa） Chain L 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.82 Å
9J8N Cryo-EM structure of BAF-Lamin A/C IgF-nucleosome complex (Low mobility complex) Deposited 2024-08-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 28 PDB declaration: 32-meric	Chain K 1–89（89 aa） Chain L 1–89（89 aa） Chain N 1–89（89 aa） Chain O 1–89（89 aa） Chain k 1–89（89 aa） Chain l 1–89（89 aa） Chain n 1–89（89 aa） Chain o 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.14 Å
9J8O Cryo-EM structure of BAF-Lamin A/C IgF-H1-nucleosome complex Deposited 2024-08-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 24 PDB declaration: 28-meric	Chain K 1–89（89 aa） Chain L 1–89（89 aa） Chain k 1–89（89 aa） Chain l 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.05 Å

27 other PDB entries and 29 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	BAF_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–89； UniProt 2–89 Author chain B； PDBConstruct 2–89； UniProt 2–89

Emerin

Homo sapiens

UniProt P50402

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain G； UniProt 2–187	Not recorded	Barrier-to-autointegration factor, N-terminally processed × 2 （O75531） EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；Hepes Sodium salt 0.1 M pH 7.5 PEG 600 25% W/V	Resolution 1.44 Å R-free 0.225

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7NDY	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1JEI LEM DOMAIN OF HUMAN INNER NUCLEAR MEMBRANE PROTEIN EMERIN Deposited 2001-06-18	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–54（53 aa） Fragment：LEM DOMAIN (RESIDUES 2-54)	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.3；298 K；Ionic strength (raw mmCIF value) 20mM NMR sample composition LEM domain of emerin 1mM \| NaH2PO4/Na2HPO4 20mM, pH 6.3, 90% H2O/10% D2O or 100% D2O	Resolution not provided
2ODC LEM-domain of the nuclear envelope protein emerin Deposited 2006-12-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain I 2–47（46 aa） Fragment：residues 2-47	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；303 K；Ionic strength (raw mmCIF value) 50 mM POTASSIUM PHOSPHATE	Resolution not provided
2ODG Complex of barrier-to-autointegration factor and LEM-domain of emerin Deposited 2006-12-22	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 2–47（46 aa） Fragment：RESIDUES 2-47	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；303 K；Ionic strength (raw mmCIF value) 50 mM POTASSIUM PHOSPHATE 200 mM NACL	Resolution not provided
6GHD Structural analysis of the ternary complex between lamin A/C, BAF and emerin identifies an interface disrupted in autosomal recessive progeroid diseases Deposited 2018-05-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain G 2–45（44 aa）	Not recorded	SO4 SULFATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；25% PEG3.350, 20mM Tris-BispH5.5, 30mM NaCl, 0.2M NH4SO4	Resolution 2.10 Å R-free 0.247
6GHD Structural analysis of the ternary complex between lamin A/C, BAF and emerin identifies an interface disrupted in autosomal recessive progeroid diseases Deposited 2018-05-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain H 2–45（44 aa）	Not recorded	SO4 SULFATE ION × 3 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；25% PEG3.350, 20mM Tris-BispH5.5, 30mM NaCl, 0.2M NH4SO4	Resolution 2.10 Å R-free 0.247

4 other PDB entries and 5 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	EMD_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain G； PDBConstruct 2–187； UniProt 2–187

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7ndy
Deposition date deposition_date	2021-02-02
Structure title title	Di-phosphorylated Barrier-to-Autointegration Factor (BAF) in complex with LEM domain of Emerin
Keywords keywords	Phosphorylation Complex High Resolution, DNA BINDING PROTEIN; DNA BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	19.09 Å
Radius of gyration Rg (electron density) rg_electron	17.46 Å
Forward intensity I(0) i0	11535000.00
Molecular weight molecular_weight	25058.0 kDa
Excluded volume excluded_volume	31278 Å³
Envelope volume envelope_volume	35402 Å³
Hydration-shell volume shell_volume	17065 Å³
Envelope diameter envelope_diameter	60.0 Å
Shell Rg shell_rg	23.56 Å
Envelope Rg envelope_rg	17.82 Å
Shape Rg shape_rg	17.39 Å
Total Rg total_rg	18.61 Å
Total atoms total_atoms	1764
Residues n_residues	214
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	58.6 Å
Rg (real space) rg_real	18.99 Å
Rg uncertainty (real space) rg_real_error	0.28 Å
I(0) (real space) i0_real	1.1540e+07
I(0) uncertainty (real space) i0_real_error	1.3750e+05
Rg (reciprocal space) rg_reciprocal	19.01 Å
I(0) (reciprocal space) i0_reciprocal	11540000.0000
Solution quality estimate total_estimate	0.7452
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	22.0 Å
Skewness Skewness skewness	0.173
Kurtosis Kurtosis kurtosis	-0.504
Angular range angular_range	— – 0.4150 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	2285000.0000
Real-space data points n_real_points	73
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.943; Stabil: 1.000; Sysdev: 0.295; Positv: 1.000; Valcen: 0.997; Smooth: 0.971

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Barrier-to-autointegration factor, N-terminally processed
Molecular weight formula_weight	10031.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	2008

GTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTAGANAKQSRDAFGALREWADAFL

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Emerin
Molecular weight formula_weight	21372.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

GDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRLSPPSSSAASSYSFSDLNSTRGDADMYDLPKKEDALLYQSKGYNDDYYEESYFTTRTYGEPESAGPSRAVRQSVTSFPDADAFHHQVHDDDLLSSSEEECKDRERPMYGRDSAYQSITHYRPVSASRSSLDLSYYPTSSS

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID
Molecular weight formula_weight	238.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	208

▼

7. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d7ndya_
Class class	a — All alpha proteins
Fold Fold fold	a.60 — SAM domain-like
Superfamily Superfamily superfamily	a.60.5 — Barrier-to-autointegration factor, BAF
Family Family family	a.60.5.1 — Barrier-to-autointegration factor, BAF

Domain ID domain_id	d7ndyb_
Class class	a — All alpha proteins
Fold Fold fold	a.60 — SAM domain-like
Superfamily Superfamily superfamily	a.60.5 — Barrier-to-autointegration factor, BAF
Family Family family	a.60.5.1 — Barrier-to-autointegration factor, BAF

Domain ID domain_id	d7ndyg_
Class class	a — All alpha proteins
Fold Fold fold	a.140 — LEM/SAP HeH motif
Superfamily Superfamily superfamily	a.140.1 — LEM domain
Family Family family	a.140.1.1 — LEM domain

▶

8. Citations (1)

▶

Unit-cell length a length_a	33.050 Å
Unit-cell length b length_b	40.628 Å
Unit-cell length c length_c	43.224 Å
Unit-cell angle α angle_alpha	69.51 °
Unit-cell angle β angle_beta	69.68 °
Unit-cell angle γ angle_gamma	85.03 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	1.440 Å
Low-resolution limit resolution_low	38.030 Å
R factor r_factor	0.1829
R_work r_work	0.1808
R_free r_free	0.2250

fit	/app/data/saxs_computation/nd/7ndy/7ndy.fit
pddf	/app/data/pr_computation/nd/7ndy/7ndy.pr.out
profile	/app/data/saxs_computation/nd/7ndy/7ndy.dat

Di-phosphorylated Barrier-to-Autointegration Factor (BAF) in complex with LEM domain of Emerin

1. Protein Identity and Related Structures Protein Identity & Related Structures

Barrier-to-autointegration factor, N-terminally processed

State in the Current Structure

Other States of the Same Protein in the Database

Emerin

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (3 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)