7o5h

Ribosomal methyltransferase KsgA bound to small ribosomal subunit

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ribosomal RNA small subunit methyltransferase A

Escherichia coli (strain K12)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 14 RNA 1	16S rRNA × 1 30S ribosomal protein S2 × 1 （A0A3K3SDJ5） 30S ribosomal protein S4 × 1 （V0YKB3） 30S ribosomal protein S5 × 1 （A1AGJ2） 30S ribosomal protein S6, fully modified isoform × 1 （P02358） 30S ribosomal protein S8 × 1 （H4JDM0） 30S ribosomal protein S11 × 1 （A0A5I5F5V9） 30S ribosomal protein S12 × 1 （I2UHF1） 30S ribosomal protein S15 × 1 （E9YUR8） 30S ribosomal protein S16 × 1 （C3SYP2） 30S ribosomal protein S17 × 1 （T6LV72） 30S ribosomal protein S18 × 1 （A7ZV73） 30S ribosomal protein S20 × 1 （I4T5W9） 30S ribosomal protein S21 × 1 （A0A5C9AJ78） MAGNESIUM ION × 167	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4S5B3V1_ECOLI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain V； PDBConstruct 1–252； UniProt 17–268

30S ribosomal protein S2

OrganismNot specified

UniProt A0A3K3SDJ5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 14 RNA 1	Ribosomal RNA small subunit methyltransferase A × 1 （A0A4S5B3V1） 16S rRNA × 1 30S ribosomal protein S4 × 1 （V0YKB3） 30S ribosomal protein S5 × 1 （A1AGJ2） 30S ribosomal protein S6, fully modified isoform × 1 （P02358） 30S ribosomal protein S8 × 1 （H4JDM0） 30S ribosomal protein S11 × 1 （A0A5I5F5V9） 30S ribosomal protein S12 × 1 （I2UHF1） 30S ribosomal protein S15 × 1 （E9YUR8） 30S ribosomal protein S16 × 1 （C3SYP2） 30S ribosomal protein S17 × 1 （T6LV72） 30S ribosomal protein S18 × 1 （A7ZV73） 30S ribosomal protein S20 × 1 （I4T5W9） 30S ribosomal protein S21 × 1 （A0A5C9AJ78） MAGNESIUM ION × 167	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A3K3SDJ5_ECOLX
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain B； PDBConstruct 1–225； UniProt 3–227

30S ribosomal protein S4

OrganismNot specified

UniProt V0YKB3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 14 RNA 1	Ribosomal RNA small subunit methyltransferase A × 1 （A0A4S5B3V1） 16S rRNA × 1 30S ribosomal protein S2 × 1 （A0A3K3SDJ5） 30S ribosomal protein S5 × 1 （A1AGJ2） 30S ribosomal protein S6, fully modified isoform × 1 （P02358） 30S ribosomal protein S8 × 1 （H4JDM0） 30S ribosomal protein S11 × 1 （A0A5I5F5V9） 30S ribosomal protein S12 × 1 （I2UHF1） 30S ribosomal protein S15 × 1 （E9YUR8） 30S ribosomal protein S16 × 1 （C3SYP2） 30S ribosomal protein S17 × 1 （T6LV72） 30S ribosomal protein S18 × 1 （A7ZV73） 30S ribosomal protein S20 × 1 （I4T5W9） 30S ribosomal protein S21 × 1 （A0A5C9AJ78） MAGNESIUM ION × 167	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	V0YKB3_ECOLX
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–205； UniProt 2–206

30S ribosomal protein S5

OrganismNot specified

UniProt A1AGJ2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 14 RNA 1	Ribosomal RNA small subunit methyltransferase A × 1 （A0A4S5B3V1） 16S rRNA × 1 30S ribosomal protein S2 × 1 （A0A3K3SDJ5） 30S ribosomal protein S4 × 1 （V0YKB3） 30S ribosomal protein S6, fully modified isoform × 1 （P02358） 30S ribosomal protein S8 × 1 （H4JDM0） 30S ribosomal protein S11 × 1 （A0A5I5F5V9） 30S ribosomal protein S12 × 1 （I2UHF1） 30S ribosomal protein S15 × 1 （E9YUR8） 30S ribosomal protein S16 × 1 （C3SYP2） 30S ribosomal protein S17 × 1 （T6LV72） 30S ribosomal protein S18 × 1 （A7ZV73） 30S ribosomal protein S20 × 1 （I4T5W9） 30S ribosomal protein S21 × 1 （A0A5C9AJ78） MAGNESIUM ION × 167	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS5_ECOK1
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–158； UniProt 10–167

30S ribosomal protein S6, fully modified isoform

OrganismNot specified

UniProt P02358

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 14 RNA 1	Ribosomal RNA small subunit methyltransferase A × 1 （A0A4S5B3V1） 16S rRNA × 1 30S ribosomal protein S2 × 1 （A0A3K3SDJ5） 30S ribosomal protein S4 × 1 （V0YKB3） 30S ribosomal protein S5 × 1 （A1AGJ2） 30S ribosomal protein S8 × 1 （H4JDM0） 30S ribosomal protein S11 × 1 （A0A5I5F5V9） 30S ribosomal protein S12 × 1 （I2UHF1） 30S ribosomal protein S15 × 1 （E9YUR8） 30S ribosomal protein S16 × 1 （C3SYP2） 30S ribosomal protein S17 × 1 （T6LV72） 30S ribosomal protein S18 × 1 （A7ZV73） 30S ribosomal protein S20 × 1 （I4T5W9） 30S ribosomal protein S21 × 1 （A0A5C9AJ78） MAGNESIUM ION × 167	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS6_ECOLI
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–106； UniProt 1–106

30S ribosomal protein S8

OrganismNot specified

UniProt H4JDM0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 14 RNA 1	Ribosomal RNA small subunit methyltransferase A × 1 （A0A4S5B3V1） 16S rRNA × 1 30S ribosomal protein S2 × 1 （A0A3K3SDJ5） 30S ribosomal protein S4 × 1 （V0YKB3） 30S ribosomal protein S5 × 1 （A1AGJ2） 30S ribosomal protein S6, fully modified isoform × 1 （P02358） 30S ribosomal protein S11 × 1 （A0A5I5F5V9） 30S ribosomal protein S12 × 1 （I2UHF1） 30S ribosomal protein S15 × 1 （E9YUR8） 30S ribosomal protein S16 × 1 （C3SYP2） 30S ribosomal protein S17 × 1 （T6LV72） 30S ribosomal protein S18 × 1 （A7ZV73） 30S ribosomal protein S20 × 1 （I4T5W9） 30S ribosomal protein S21 × 1 （A0A5C9AJ78） MAGNESIUM ION × 167	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H4JDM0_ECOLX
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain H； PDBConstruct 1–129； UniProt 2–130

30S ribosomal protein S11

OrganismNot specified

UniProt A0A5I5F5V9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 14 RNA 1	Ribosomal RNA small subunit methyltransferase A × 1 （A0A4S5B3V1） 16S rRNA × 1 30S ribosomal protein S2 × 1 （A0A3K3SDJ5） 30S ribosomal protein S4 × 1 （V0YKB3） 30S ribosomal protein S5 × 1 （A1AGJ2） 30S ribosomal protein S6, fully modified isoform × 1 （P02358） 30S ribosomal protein S8 × 1 （H4JDM0） 30S ribosomal protein S12 × 1 （I2UHF1） 30S ribosomal protein S15 × 1 （E9YUR8） 30S ribosomal protein S16 × 1 （C3SYP2） 30S ribosomal protein S17 × 1 （T6LV72） 30S ribosomal protein S18 × 1 （A7ZV73） 30S ribosomal protein S20 × 1 （I4T5W9） 30S ribosomal protein S21 × 1 （A0A5C9AJ78） MAGNESIUM ION × 167	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A5I5F5V9_SALET
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain K； PDBConstruct 1–117； UniProt 13–129

30S ribosomal protein S12

OrganismNot specified

UniProt I2UHF1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 14 RNA 1	Ribosomal RNA small subunit methyltransferase A × 1 （A0A4S5B3V1） 16S rRNA × 1 30S ribosomal protein S2 × 1 （A0A3K3SDJ5） 30S ribosomal protein S4 × 1 （V0YKB3） 30S ribosomal protein S5 × 1 （A1AGJ2） 30S ribosomal protein S6, fully modified isoform × 1 （P02358） 30S ribosomal protein S8 × 1 （H4JDM0） 30S ribosomal protein S11 × 1 （A0A5I5F5V9） 30S ribosomal protein S15 × 1 （E9YUR8） 30S ribosomal protein S16 × 1 （C3SYP2） 30S ribosomal protein S17 × 1 （T6LV72） 30S ribosomal protein S18 × 1 （A7ZV73） 30S ribosomal protein S20 × 1 （I4T5W9） 30S ribosomal protein S21 × 1 （A0A5C9AJ78） MAGNESIUM ION × 167	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I2UHF1_ECOLX
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain L； PDBConstruct 1–123； UniProt 2–124

30S ribosomal protein S15

OrganismNot specified

UniProt E9YUR8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 14 RNA 1	Ribosomal RNA small subunit methyltransferase A × 1 （A0A4S5B3V1） 16S rRNA × 1 30S ribosomal protein S2 × 1 （A0A3K3SDJ5） 30S ribosomal protein S4 × 1 （V0YKB3） 30S ribosomal protein S5 × 1 （A1AGJ2） 30S ribosomal protein S6, fully modified isoform × 1 （P02358） 30S ribosomal protein S8 × 1 （H4JDM0） 30S ribosomal protein S11 × 1 （A0A5I5F5V9） 30S ribosomal protein S12 × 1 （I2UHF1） 30S ribosomal protein S16 × 1 （C3SYP2） 30S ribosomal protein S17 × 1 （T6LV72） 30S ribosomal protein S18 × 1 （A7ZV73） 30S ribosomal protein S20 × 1 （I4T5W9） 30S ribosomal protein S21 × 1 （A0A5C9AJ78） MAGNESIUM ION × 167	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E9YUR8_ECOLX
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain O； PDBConstruct 1–88； UniProt 2–89

30S ribosomal protein S16

OrganismNot specified

UniProt C3SYP2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 14 RNA 1	Ribosomal RNA small subunit methyltransferase A × 1 （A0A4S5B3V1） 16S rRNA × 1 30S ribosomal protein S2 × 1 （A0A3K3SDJ5） 30S ribosomal protein S4 × 1 （V0YKB3） 30S ribosomal protein S5 × 1 （A1AGJ2） 30S ribosomal protein S6, fully modified isoform × 1 （P02358） 30S ribosomal protein S8 × 1 （H4JDM0） 30S ribosomal protein S11 × 1 （A0A5I5F5V9） 30S ribosomal protein S12 × 1 （I2UHF1） 30S ribosomal protein S15 × 1 （E9YUR8） 30S ribosomal protein S17 × 1 （T6LV72） 30S ribosomal protein S18 × 1 （A7ZV73） 30S ribosomal protein S20 × 1 （I4T5W9） 30S ribosomal protein S21 × 1 （A0A5C9AJ78） MAGNESIUM ION × 167	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C3SYP2_ECOLX
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain P； PDBConstruct 1–82； UniProt 1–82

30S ribosomal protein S17

OrganismNot specified

UniProt T6LV72

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 14 RNA 1	Ribosomal RNA small subunit methyltransferase A × 1 （A0A4S5B3V1） 16S rRNA × 1 30S ribosomal protein S2 × 1 （A0A3K3SDJ5） 30S ribosomal protein S4 × 1 （V0YKB3） 30S ribosomal protein S5 × 1 （A1AGJ2） 30S ribosomal protein S6, fully modified isoform × 1 （P02358） 30S ribosomal protein S8 × 1 （H4JDM0） 30S ribosomal protein S11 × 1 （A0A5I5F5V9） 30S ribosomal protein S12 × 1 （I2UHF1） 30S ribosomal protein S15 × 1 （E9YUR8） 30S ribosomal protein S16 × 1 （C3SYP2） 30S ribosomal protein S18 × 1 （A7ZV73） 30S ribosomal protein S20 × 1 （I4T5W9） 30S ribosomal protein S21 × 1 （A0A5C9AJ78） MAGNESIUM ION × 167	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T6LV72_ECOLX
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain Q； PDBConstruct 1–80； UniProt 4–83

30S ribosomal protein S18

OrganismNot specified

UniProt A7ZV73

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 14 RNA 1	Ribosomal RNA small subunit methyltransferase A × 1 （A0A4S5B3V1） 16S rRNA × 1 30S ribosomal protein S2 × 1 （A0A3K3SDJ5） 30S ribosomal protein S4 × 1 （V0YKB3） 30S ribosomal protein S5 × 1 （A1AGJ2） 30S ribosomal protein S6, fully modified isoform × 1 （P02358） 30S ribosomal protein S8 × 1 （H4JDM0） 30S ribosomal protein S11 × 1 （A0A5I5F5V9） 30S ribosomal protein S12 × 1 （I2UHF1） 30S ribosomal protein S15 × 1 （E9YUR8） 30S ribosomal protein S16 × 1 （C3SYP2） 30S ribosomal protein S17 × 1 （T6LV72） 30S ribosomal protein S20 × 1 （I4T5W9） 30S ribosomal protein S21 × 1 （A0A5C9AJ78） MAGNESIUM ION × 167	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS18_ECO24
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain R； PDBConstruct 1–55； UniProt 20–74

30S ribosomal protein S20

OrganismNot specified

UniProt I4T5W9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 14 RNA 1	Ribosomal RNA small subunit methyltransferase A × 1 （A0A4S5B3V1） 16S rRNA × 1 30S ribosomal protein S2 × 1 （A0A3K3SDJ5） 30S ribosomal protein S4 × 1 （V0YKB3） 30S ribosomal protein S5 × 1 （A1AGJ2） 30S ribosomal protein S6, fully modified isoform × 1 （P02358） 30S ribosomal protein S8 × 1 （H4JDM0） 30S ribosomal protein S11 × 1 （A0A5I5F5V9） 30S ribosomal protein S12 × 1 （I2UHF1） 30S ribosomal protein S15 × 1 （E9YUR8） 30S ribosomal protein S16 × 1 （C3SYP2） 30S ribosomal protein S17 × 1 （T6LV72） 30S ribosomal protein S18 × 1 （A7ZV73） 30S ribosomal protein S21 × 1 （A0A5C9AJ78） MAGNESIUM ION × 167	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I4T5W9_ECOLX
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain T； PDBConstruct 1–86； UniProt 2–87

30S ribosomal protein S21

OrganismNot specified

UniProt A0A5C9AJ78

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 14 RNA 1	Ribosomal RNA small subunit methyltransferase A × 1 （A0A4S5B3V1） 16S rRNA × 1 30S ribosomal protein S2 × 1 （A0A3K3SDJ5） 30S ribosomal protein S4 × 1 （V0YKB3） 30S ribosomal protein S5 × 1 （A1AGJ2） 30S ribosomal protein S6, fully modified isoform × 1 （P02358） 30S ribosomal protein S8 × 1 （H4JDM0） 30S ribosomal protein S11 × 1 （A0A5I5F5V9） 30S ribosomal protein S12 × 1 （I2UHF1） 30S ribosomal protein S15 × 1 （E9YUR8） 30S ribosomal protein S16 × 1 （C3SYP2） 30S ribosomal protein S17 × 1 （T6LV72） 30S ribosomal protein S18 × 1 （A7ZV73） 30S ribosomal protein S20 × 1 （I4T5W9） MAGNESIUM ION × 167	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A5C9AJ78_ECOLX
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain U； PDBConstruct 1–56； UniProt 2–57

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7o5h
Deposition date deposition_date	2021-04-08
Structure title title	Ribosomal methyltransferase KsgA bound to small ribosomal subunit
Keywords keywords	Methyltransferase KsgA, 30S, RIBOSOME; RIBOSOME
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7o5h__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7o5h__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7o5h__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	55.78 Å
Rg (electron density)	56.33 Å
Total Rg	56.34 Å
Atom count	34436
Residues	2694
Excluded volume	537300 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7o5h__assembly_1__model_1`	pentadecameric （15）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (16)

Entity 1 Entity 1 polymer

Description description	Ribosomal RNA small subunit methyltransferase A
Molecular weight formula_weight	27988.3 kDa
EC 编号 ec_number	2.1.1.182
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V
Atom count atom_count	34436

QNFLNDQFVIDSIVSAINPQKGQAMVEIGPGLAALTEPVGERLDQLTVIELDRDLAARLQTHPFLGPKLTIYQQDAMTFNFGELAEKMGQPLRVFGNLPYNISTPLMFHLFSYTDAIADMHFMLQKEVVNRLVAGPNSKAYGRLSVMAQYYCNVIPVLEVPPSAFTPPPKVDSAVVRLVPHATMPHPVKDVRVLSRITTEAFNQRRKTIRNSLGNLFSVEVLTGMGIDPAMRAENISVAQYCQMANYLAENA

Source Source

Source organism organism	Escherichia coli (strain K12)
NCBI taxonomy ID ncbi_taxonomy_id	83333
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	16S rRNA
Molecular weight formula_weight	312980.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	A

AAAUUGAAGAGUUUGAUCAUGGCUCAGAUUGAACGCUGGCGGCAGGCCUAACACAUGCAAGUCGAACGGUAACAGGAUUGCUGACGAGUGGCGGACGGGUGAGUAAUGUCUGGGAAACUGCCUGAUGGAGGGGGAUAACUACUGGAAACGGUAGCUAAUACCGCAUAACGUCGCAAGACCAAAGAGGGGGACCUUCGGGCCUCUUGCCAUCGGAUGUGCCCAGAUGGGAUUAGCUAGUAGGUGGGGUAACGGCUCACCUAGGCGACGAUCCCUAGCUGGUCUGAGAGGAUGACCAGCCACACUGGAACUGAGACACGGUCCAGACUCCUACGGGAGGCAGCAGUGGGGAAUAUUGCACAAUGGGCGCAAGCCUGAUGCAGCCAUGCCGCGUGUAUGAAGAAGGCCUUCGGGUUGUAAAGUACUUUCAGCGGGGAGGAAGGGAGUAAAGUUAAUACCUUUGCUCAUUGACGUUACCCGCAGAAGAAGCACCGGCUAACUCCGUGCCAGCAGCCGCGGUAAUACGGAGGGUGCAAGCGUUAAUCGGAAUUACUGGGCGUAAAGCGCACGCAGGCGGUUUGUUAAGUCAGAUGUGAAAUCCCCGGGCUCAACCUGGGAACUGCAUCUGAUACUGGCAAGCUUGAGUCUCGUAGAGGGGGGUAGAAUUCCAGGUGUAGCGGUGAAAUGCGUAGAGAUCUGGAGGAAUACCGGUGGCGAAGGCGGCCCCCUGGACGAAGACUGACGCUCAGGUGCGAAAGCGUGGGGAGCAAACAGGAUCCUGGUAGUCCACGCCGUAAACGAUGUCGACUUGGAGGUUGUGCCGGCGUGGCUUCCGGAGCUAACGCGUUAAGUCGACCGCCUGGGGAGUACGGCCGCAAGGUUAAAACUCAAAUGAAUUGACGCUCGUGUUGUGAAAUGUUGGGUUCCCGCAACGAGCGGUACAAACCGUAGGGGAACCUGCGGUUGG

Entity 3 Entity 3 polymer

Description description	30S ribosomal protein S2
Molecular weight formula_weight	25072.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

TVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFNEALAELNKIASRKGKILFVGTKRAASEAVKDAALSCDQFFVNHRWLGGMLTNWKTVRQSIKRLKDLETQSQDGTFDKLTKKEALMRTRELEKLENSLGGIKDMGGLPDALFVIDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVTLYLGAVAATVREGRSQ

Entity 4 Entity 4 polymer

Description description	30S ribosomal protein S4
Molecular weight formula_weight	23383.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

ARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIEQAPGQHGARKPRLSDYGVQLREKQKVRRIYGVLERQFRNYYKEAARLKGNTGENLLALLEGRLDNVVYRMGFGATRAEARQLVSHKAIMVNGRVVNIASYQVSPNDVVSIREKAKKQSRVKAALELAEQREKPTWLEVDAGKMEGTFKRKPERSDLSADINEHLIVELYSK

Entity 5 Entity 5 polymer

Description description	30S ribosomal protein S5
Molecular weight formula_weight	16661.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

ELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLENMNSPEMVAAKRGKSVEEILGK

Entity 6 Entity 6 polymer

Description description	30S ribosomal protein S6, fully modified isoform
Molecular weight formula_weight	12326.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAK

Entity 7 Entity 7 polymer

Description description	30S ribosomal protein S8
Molecular weight formula_weight	14015.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

SMQDPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKVEGDTKPELELTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGIAVVSTSKGVMTDRAARQAGLGGEIICYVA

Entity 8 Entity 8 polymer

Description description	30S ribosomal protein S11
Molecular weight formula_weight	12487.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

RKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFAAQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCRPPKKRRV

Entity 9 Entity 9 polymer

Description description	30S ribosomal protein S12
Molecular weight formula_weight	13637.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

ATVNQLVRKPRARKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVKRPKA

Entity 10 Entity 10 polymer

Description description	30S ribosomal protein S15
Molecular weight formula_weight	10159.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYLKRKDVARYTQLIERLGLRR

Entity 11 Entity 11 polymer

Description description	30S ribosomal protein S16
Molecular weight formula_weight	9207.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MVTIRLARHGAKKRPFYQVVVADSRNARNGRFIERVGFFNPIASEKEEGTRLDLDRIAHWVGQGATISDRVAALIKEVNKAA

Entity 12 Entity 12 polymer

Description description	30S ribosomal protein S17
Molecular weight formula_weight	9263.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

KIRTLQGRVVSDKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHDENNECGIGDVVEIRECRPLSKTKSWTLVRVVEKAV

Entity 13 Entity 13 polymer

Description description	30S ribosomal protein S18
Molecular weight formula_weight	6466.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

EIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLLPYTDRH

Entity 14 Entity 14 polymer

Description description	30S ribosomal protein S20
Molecular weight formula_weight	9577.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

ANIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAFNEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA

Entity 15 Entity 15 polymer

Description description	30S ribosomal protein S21
Molecular weight formula_weight	6629.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

PVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVKRHA

Entity 16 Entity 16 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	167

▼

6. Fold Classification (SCOP + CATH) 5 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d7o5hv_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.66 — S-adenosyl-L-methionine-dependent methyltransferases
Superfamily Superfamily superfamily	c.66.1 — S-adenosyl-L-methionine-dependent methyltransferases
Family Family family	c.66.1.24 — rRNA adenine dimethylase-like

CATH v4.4 (4 domains)

Domain ID domain_id	7o5hD01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1050 — Ribosomal Protein S4 Delta 41; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Ribosomal protein S4/S9, N-terminal domain

Domain ID domain_id	7o5hD02
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	290 — Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A
Homologous superfamily homologous superfamily	10 — RNA-binding S4 domain

Domain ID domain_id	7o5hE01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	160 — Double Stranded RNA Binding Domain
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	7o5hE02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	230 — Ribosomal Protein S5; domain 2
Homologous superfamily homologous superfamily	10 —

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	165073

Ribosomal methyltransferase KsgA bound to small ribosomal subunit

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ribosomal RNA small subunit methyltransferase A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S6, fully modified isoform

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S15

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S16

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer