7pwg

Cryo-EM structure of large subunit of Giardia lamblia ribosome at 2.7 A resolution

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ribosomal protein L2

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E2RTN4_GIAIC
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain A； PDBConstruct 1–251； UniProt 1–251

Ribosomal protein L3

OrganismNot specified

UniProt A8BRZ3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BRZ3_GIAIC
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain B； PDBConstruct 1–379； UniProt 1–379

Ribosomal protein L4

OrganismNot specified

UniProt A8B7H8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8B7H8_GIAIC
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain C； PDBConstruct 1–316； UniProt 1–316

Ribosomal protein L5

OrganismNot specified

UniProt E2RU47

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E2RU47_GIAIC
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain D； PDBConstruct 1–297； UniProt 1–297

Ribosomal protein L7

OrganismNot specified

UniProt A8BRY6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BRY6_GIAIC
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain F； PDBConstruct 1–235； UniProt 1–235

60S ribosomal protein L7a

OrganismNot specified

UniProt A8BLL7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BLL7_GIAIC
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain G； PDBConstruct 1–225； UniProt 1–225

Ribosomal protein L6

OrganismNot specified

UniProt A8BNT5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BNT5_GIAIC
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain H； PDBConstruct 1–185； UniProt 1–185

Ribosomal protein L10

OrganismNot specified

UniProt A8BM86

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BM86_GIAIC
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain I； PDBConstruct 1–210； UniProt 1–210

Ribosomal protein L11

OrganismNot specified

UniProt A8BI95

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BI95_GIAIC
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain J； PDBConstruct 1–173； UniProt 1–173

60S ribosomal protein L13

OrganismNot specified

UniProt A8B6M8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8B6M8_GIAIC
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain L； PDBConstruct 1–234； UniProt 1–234

Ribosomal protein L14

OrganismNot specified

UniProt A8B4F8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8B4F8_GIAIC
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain M； PDBConstruct 1–131； UniProt 1–131

Ribosomal protein L15

OrganismNot specified

UniProt A8B8Z6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8B8Z6_GIAIC
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain N； PDBConstruct 1–204； UniProt 1–204

Ribosomal protein L13a

OrganismNot specified

UniProt A8BU75

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BU75_GIAIC
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain O； PDBConstruct 1–197； UniProt 1–197

Ribosomal protein L17

OrganismNot specified

UniProt A8BE76

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BE76_GIAIC
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain P； PDBConstruct 1–164； UniProt 1–164

Ribosomal protein L18

OrganismNot specified

UniProt A8B4T7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8B4T7_GIAIC
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain Q； PDBConstruct 1–179； UniProt 1–179

Ribosomal protein L19

OrganismNot specified

UniProt A8BH61

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BH61_GIAIC
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain R； PDBConstruct 1–196； UniProt 1–196

60S ribosomal protein L18a

OrganismNot specified

UniProt A8BT04

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BT04_GIAIC
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain S； PDBConstruct 1–173； UniProt 1–173

Ribosomal protein L21

OrganismNot specified

UniProt A8B2Q4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8B2Q4_GIAIC
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain T； PDBConstruct 1–159； UniProt 1–159

Ribosomal protein eL22

OrganismNot specified

UniProt A8BW84

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BW84_GIAIC
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain U； PDBConstruct 1–171； UniProt 1–171

Ribosomal protein L23

OrganismNot specified

UniProt A8BS37

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BS37_GIAIC
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain V； PDBConstruct 1–142； UniProt 1–142

Ribosomal protein L23A

OrganismNot specified

UniProt A8BMP6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BMP6_GIAIC
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain X； PDBConstruct 1–141； UniProt 1–141

Ribosomal protein L26

OrganismNot specified

UniProt A8BFT3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BFT3_GIAIC
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain Y； PDBConstruct 1–135； UniProt 1–135

60S ribosomal protein L27

OrganismNot specified

UniProt A8B1T3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8B1T3_GIAIC
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain Z； PDBConstruct 1–135； UniProt 1–135

Ribosomal protein L27a

OrganismNot specified

UniProt A8BZ78

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BZ78_GIAIC
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain a； PDBConstruct 1–149； UniProt 1–149

60S ribosomal protein L29

OrganismNot specified

UniProt A8BYY2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BYY2_GIAIC
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain b； PDBConstruct 1–62； UniProt 1–62

Ribosomal protein L30

OrganismNot specified

UniProt A8B5N7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8B5N7_GIAIC
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain c； PDBConstruct 1–109； UniProt 1–109

Ribosomal protein L31B

OrganismNot specified

UniProt A8BMP3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BMP3_GIAIC
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain d； PDBConstruct 1–106； UniProt 1–106

Ribosomal protein L32

OrganismNot specified

UniProt A8BMD9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BMD9_GIAIC
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain e； PDBConstruct 1–136； UniProt 1–136

Ribosomal protein L35a

OrganismNot specified

UniProt A8BKK5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BKK5_GIAIC
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain f； PDBConstruct 1–123； UniProt 1–123

Ribosomal protein L34

OrganismNot specified

UniProt A8BMF7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BMF7_GIAIC
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain g； PDBConstruct 1–120； UniProt 1–120

Ribosomal protein L29

OrganismNot specified

UniProt A0A644FBK5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A644FBK5_GIAIC
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain h； PDBConstruct 1–124； UniProt 1–124

Ribosomal protein L36-1

OrganismNot specified

UniProt A8BYA6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BYA6_GIAIC
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain i； PDBConstruct 1–90； UniProt 1–90

Ribosomal protein L37

OrganismNot specified

UniProt A8BLV7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BLV7_GIAIC
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain j； PDBConstruct 1–89； UniProt 1–89

Ribosomal L38e

OrganismNot specified

UniProt A8B481

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8B481_GIAIC
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain k； PDBConstruct 1–77； UniProt 1–77

Ribosomal protein L39

OrganismNot specified

UniProt A0A644EZB9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A644EZB9_GIAIC
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain l； PDBConstruct 1–51； UniProt 1–51

Ubiquitin/Ribosomal protein L40e

OrganismNot specified

UniProt A8BXE1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BXE1_GIAIC
Isoform	—
PDB entities	39
Chains and sequence ranges	Author chain m； PDBConstruct 1–127； UniProt 1–127

Ribosomal protein L44

OrganismNot specified

UniProt A8BQU8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BQU8_GIAIC
Isoform	—
PDB entities	40
Chains and sequence ranges	Author chain o； PDBConstruct 1–106； UniProt 1–106

Ribosomal protein L37a

OrganismNot specified

UniProt A8BN26

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） E-site tRNA × 1 Ribosomal protein L24A × 1 （A8BRH7） P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BN26_GIAIC
Isoform	—
PDB entities	41
Chains and sequence ranges	Author chain p； PDBConstruct 1–94； UniProt 1–94

Ribosomal protein L24A

OrganismNot specified

UniProt A8BRH7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 39 RNA 5	rRNA 28S × 1 rRNA 5S × 1 rRNA 5.8S × 1 Ribosomal protein L2 × 1 （E2RTN4） Ribosomal protein L3 × 1 （A8BRZ3） Ribosomal protein L4 × 1 （A8B7H8） Ribosomal protein L5 × 1 （E2RU47） Ribosomal protein L7 × 1 （A8BRY6） 60S ribosomal protein L7a × 1 （A8BLL7） Ribosomal protein L6 × 1 （A8BNT5） Ribosomal protein L10 × 1 （A8BM86） Ribosomal protein L11 × 1 （A8BI95） 60S ribosomal protein L13 × 1 （A8B6M8） Ribosomal protein L14 × 1 （A8B4F8） Ribosomal protein L15 × 1 （A8B8Z6） Ribosomal protein L13a × 1 （A8BU75） Ribosomal protein L17 × 1 （A8BE76） Ribosomal protein L18 × 1 （A8B4T7） Ribosomal protein L19 × 1 （A8BH61） 60S ribosomal protein L18a × 1 （A8BT04） Ribosomal protein L21 × 1 （A8B2Q4） Ribosomal protein eL22 × 1 （A8BW84） Ribosomal protein L23 × 1 （A8BS37） Ribosomal protein L23A × 1 （A8BMP6） Ribosomal protein L26 × 1 （A8BFT3） 60S ribosomal protein L27 × 1 （A8B1T3） Ribosomal protein L27a × 1 （A8BZ78） 60S ribosomal protein L29 × 1 （A8BYY2） Ribosomal protein L30 × 1 （A8B5N7） Ribosomal protein L31B × 1 （A8BMP3） Ribosomal protein L32 × 1 （A8BMD9） Ribosomal protein L35a × 1 （A8BKK5） Ribosomal protein L34 × 1 （A8BMF7） Ribosomal protein L29 × 1 （A0A644FBK5） Ribosomal protein L36-1 × 1 （A8BYA6） Ribosomal protein L37 × 1 （A8BLV7） Ribosomal L38e × 1 （A8B481） Ribosomal protein L39 × 1 （A0A644EZB9） Ubiquitin/Ribosomal protein L40e × 1 （A8BXE1） Ribosomal protein L44 × 1 （A8BQU8） Ribosomal protein L37a × 1 （A8BN26） E-site tRNA × 1 P-site tRNA × 1 MAGNESIUM ION × 112 POTASSIUM ION × 181 TRIETHYLENE GLYCOL × 1 water × 44	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BRH7_GIAIC
Isoform	—
PDB entities	43
Chains and sequence ranges	Author chain W； PDBConstruct 1–102； UniProt 1–102

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7pwg
Deposition date deposition_date	2021-10-06
Structure title title	Cryo-EM structure of large subunit of Giardia lamblia ribosome at 2.7 A resolution
Keywords keywords	ribosome, giardia, parasite; RIBOSOME
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7pwg__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7pwg__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7pwg__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	72.04 Å
Rg (electron density)	73.87 Å
Total Rg	73.57 Å
Atom count	104754
Residues	8466
Excluded volume	1663900 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7pwg__assembly_1__model_1`	44-meric （44）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (48)

Entity 1 Entity 1 polymer

Description description	rRNA 28S
Molecular weight formula_weight	878254.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	1
Atom count atom_count	109151

GCGCGGCCCGAGGCGGCGGGGGCGACGGGCGGAACUUAAGCAUAUCAGUACGCCCCGGAGGAGAAACCAACCGGGAUUCCCCGUAGCGGCGAGCGACGCGGGAGGAGCCCGCCCCGAAGGCGCGCUGUGGGGCGCAGGCGCAGGCCCGCCGCGAGGGGGCCCGAGGGCCCCGCCCGAGAGGGUGCAAGCCCCGUACGGCGGCCGCCGGGCCUGCGCGGCGAGUAGCGCUGCUUGAGCGUGCAGCGCGAAGGGAGGCGCGGCCCUUCCAAGGCUAAAUACGCCCCGGGACCGAUAGCGGACCAAGUAGCGCGAGCGAACGGUGAAAAGGACGCCCUGCGGCCGCUCAAAAGACCUGAACCCGGCCGGCCGCCGGCCCGCCGGCCCCGUCUCGAAACACGGACCGAGGAGCCACGCGCCGCGGCGAGCCCGAGGGAGCCCCCGCGGCGGAGCGAGCGCGAGACGCCCCGGGCCCGCCGCGCCCCUGCGGGCGUGCGCGGGCCGAGCCGCGGCGCGUGGGCCCGAAAGGCGGUGAUCUAUGCCCGGCGAGGGCGAGGCCGGGCGAAAGCCUGGUGGAGGCCCGCCGCGGUGCUGACGCGCAGAUCGCUCGUCGGAGCCGGGCAUGGGGGCGAAAGACUCAUCGAACCGCCUGGUAGCUGGUUGCCUCCGAAAUGUCUCCCAGGACAGCCGCCGCCCCGCAGUUGCGGCCCGUAGAGCGCUGGCCGGCGGGAGCGGGGGGCCUGCCCCUCGCCCGCCCCCCAAACUCCGAAGGGCCGCGCCGCCCCGCCGCUGGCCUGGGCGGGGCGGGCGAAUGCGGGCGGCGCGUGGGCCCCUCCUGGUAAGCAGGACGGGCGAGGCGGGACGAUCCGGACGCCGGGCCAGGGUGCGCCGCCGGGGCCCGCGGAACGGCGUCGGCCGGUCCCGACAGCUGGAAGGUGGCCCCAGAAGUCGGCAUCCUCCAGGGAGUGUGUAACAACCCACCAGCCGAAUCGGCCGGCCCGGAAAAUGGAGCGCGCCGGAGCCCCGGACCCGCGCCCGGCCGCCGCGCGCGGCGGGUAGGAGGCCGCAGAGGCCCCGGGGGCGAAGGCGGCGCGCAGGCCCCGCCGGACCGGCCUCUGGUGCAGAUCUCGGCAGCAGUAGCCGCUACUCCGCGCCCCGGAGGACUGAGGGGGAGACGGGUUCCGCGGCGCCUGCAUCUGGCCGCGGGUGACUCGGGCCUAAGCGGCGGGUGAAGACCGGGAAGGGGCGUGCCCGCCCGUCGAACGGGGAGCCGGCGGAGACUCCGGCAGGCGCGGCCCCCGCGGAGACGCCCGCCCCCCGGCGACGCGCACGGGGACCGCGGCGGGCGGCGCCCCGGCCCGCGAACGCCCCGCAGCCCCCGGACGCCUUGCGCGGAGAGGGGGGCCCGGGGGCGGACCCCGCGCGUCCCCGGCCGCCCCUGAAAAGCCGGGGGGCGCCGGCCGCGCGCCGUACCGACCGCAGCAGGACUCCGGGGUCAGCAGCCUCUAGCGCGGGAGCGAACGCGGCUCAGGGAAGUCGGCAAGCCGGCUCCGUAACCUCGGGAAAAGGAGUGGCUCUGACGGCGCGCCGGGUCAGAACUGGAACGGACGCGGGGAUCCCGACUGUUUACUAGAAACACAGCGUCGCGAGGGCCGCACCCGGCGCUGGCGCGACGUGAUUUCUGCCCAGUGCCACGACCGUCACCGUGAAGCGAUCCGCCGAAGCCCUGGUAAACGGCGGGAGUAACUAUGACUCUCUUAAGGUAGCCAAAUGCCUCGUCGGGCAAUUUCCGACGUGCAUGAAUGGACCAACGAGGAUCCCACUGUCCCGAGCCGCGCCUCCGCGAGCCUCCAGCCUCGGGAACGGGCGAGGGCCGGCCAGCGGGGCAAGAAGACCCUUUUGAGCUUGACUCCAGCCCGGGCCUGUGGGGCGGGGCGGCCGGCGCAGCGCACAGGGGAGGCCGCGCCCCUGAGACACCCUGACGGCCGCCGCCGCCCCGCUCACCCGGUCGCGCGGGGACCCGCCCGGGCGGGGAGUUCGGCUGGGGCGGCGCGCCUGCUACACCGGACCGCAGGCGUCCCACGGCGGGCUCAGCGAGGACGGAGACCUCCCGCGGAGCAGAAGGGCACAAGCCCGCCCGACCCGCGCCCCCCGUGCCGGCGCGGGCCGCGAAAGCGGGGCCUACCGAUCCUUCGCCGCCCCGGCCGCGGGCGCGGAGGUGGCAGAAAAGUUACCACAGGGAUAACUGGCUUGUGGCCGCCGAGCGCCCGCAGCGACGCGGCUUUUUGAUCCUUCGAUGUCGGCUCUUCCUACCGUCCGCGCGCACCGGCGCGGAAGCGUCGGAUUGUUCACCCGUUCAAGGGAUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGUUAGUUUUACCCUACUGGCCCCGGGGCCAGAGCACGGCGGGCCAGUACGAGAGGAACGCCCGCCGCGGGCGCCCAGCCCCGCGGUUGCCCGCCGGGGCAGGACCGCGCGCCCGGGCCCGGGGGCCUGGCGCUGCCGCCUCUAAAGCGCCACCCCCCCCUCCGGCCCCGCCGGGCCCGCGCCCCAGCCCCGUGCCCCCUGCCCGAGGCGGCCCCCGCCCGGGAGGACCACCCGGCGCGGCGCCCCUGUACGGCGCAGGGCCUGCGAUCGCGUUCGCCCGGGGGGCGCGCCGGGCGGGCGCGCGGCCCACUUGCU

Entity 2 Entity 2 polymer

Description description	rRNA 5S
Molecular weight formula_weight	38671.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	3

CAGUUCGGCCAUCCUACGGCGGAAACUCCUUAACUCGUUCCGAAUUAAGAAGAGAAGCGCCGUCAGGCCCCGCCAGUACUGCGAUCGGAGACGUCGUGGGAACACGGGGUGCCGAACCUU

Entity 3 Entity 3 polymer

Description description	rRNA 5.8S
Molecular weight formula_weight	44972.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	4

GAACGCCCCGCCGGCGGAUGCCUCGGCCCGGGCGGCGACGAAGAGCGCGGCGGAGCGCGAGACGCGGUGCGGACCCGCCCGCCCCGAGAAGCACCGACCCUCGAACGCAGCGCGCCCCGGCGCCGCCGCCUCGGCGCCC

Entity 4 Entity 4 polymer

Description description	Ribosomal protein L2
Molecular weight formula_weight	27090.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MGRRIRVQRKGAGSVFRAHVARRLGAAKLRANDFAERTGSVRGVVKAILHDRGRGAPLARVQFPNMRGEGRVNELFIAPEGMYTGQEVFSGNKATLHIGNILPVGNIPEGTYVCNVEEKPMDRGCLARASGTYCLVVAHNMETNKTRIRLPSGQKKLISSKARAMIGLVAGGGRTDKPLLKAGNAYHKYKAKRNCWPVVRGVAMNPVDHPHGGGNHQHIGVSSCVPRNAVPGQKVGLIAARRTGCSGGKRR

Entity 5 Entity 5 polymer

Description description	Ribosomal protein L3
Molecular weight formula_weight	42715.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSHRKFSCCRKGNLGYLPRKRCTRGRGRCKTFPPDVQGAPIHLTAFLGYKAGCTHVMRFIDHRGSNLHNRQAIDQATIIDAPPMICTAIIGYAKTPKGLRAVTTVWAAHIAEPAMRRFYRNYFHAEKTAFSTYMKKAADGTYIKEQLGRLKQHADVIRIVAHTQPALTPLKQKKADIMEIQVNGGANVAEKVDYAYALMEKPISIKDVFSVGAQIDTISITRGRGFEGVVTRWGVTRLPRKTRRGNRKVACIGAWHPANVQYTVARAGQMGYFHRTDTNKQVFMIDTAENPRCCTTEFDLTDKSINPVGGFVNYGRVQGDFIMIKGTCPGPKRRPVVMRNALLPHRNCPPVQLQWISTASKFGHGIFETVEERRQFYAK

Entity 6 Entity 6 polymer

Description description	Ribosomal protein L4
Molecular weight formula_weight	35048.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MNPTVKVFGPTGTQVAELPRPKVFNVPLRPDIINFVHTQLRKCLRTPYAVSRYAGVQCTAHSWGPGRAVARLPRKHGGIGAYANFARGGHMAHPTTVIRRWCRKVNLNQRRYAVASALAASANAALVEARGHRIADVPSIPLVVDTDNVTKTKDALAIIKAVGVLRDVERCKDSRHIRAGRGKMRNRRYITRKGPLVIYNTEDVARGFRNLPGVDLCHVSSIRLLELAPGSHPGRLILWTKSAFASLDDVYAAKQNYTLPRSCITQTDIERILQSDAVQKTFVPKRDPLVIERKVDPFSSKEALARLDPSGTVMPK

Entity 7 Entity 7 polymer

Description description	Ribosomal protein L5
Molecular weight formula_weight	33961.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MGWVKVQKTRSYFKRFQVQFRRRREGKTDYQARKALIIQDKNKYATPRYRFVVRRTNKDIICQVTAAELTKDRVVCAAYSHELPRYGIPVGLTNYAAAYATGLLCGRRLLEKLSVGIKENALAQLYPGLDKATGEEYHPDENENEEVHAFKAFLDIGLARASTGARVFAAMKGAVDAGLNIPHSMKRFPGYSKDGFDSSALRDRIMGKHVGDYMAELKAEDEETYRKRFSKYIAAKVEPLRLEAMYTKAHAAIRANPQAVKAKFEIKKPVRQARLTLKERKERIDAKKLEALKQLTK

Entity 8 Entity 8 polymer

Description description	Ribosomal protein L7
Molecular weight formula_weight	27103.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MPIPELVLKHRRKVQRDIRSAAERATEKEKRAALVKDHAVKSAQVYARYYIDLVESEKKARENALKNNQLYVPDEPKVYLVVRIRGIVGVAPKVRTILSLLRLRQINNAVFMRCNKATLNALRIVDHYVTYGEPTVETIRNLIYKRGFAKVNGQRIPIVDNNLIDEQLSKHNILCAEDLVHEIFTCGSSFKEANNFLWPFQLNSAALKDKRNNFAEGGDFGYRGKYINEFVARMI

Entity 9 Entity 9 polymer

Description description	60S ribosomal protein L7a
Molecular weight formula_weight	25427.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MSKVSGSDIKRALAVPENKSRSKCDFDLTPFVRWPRQVRIQRQKAVLQRRLKVPPTVNQFMNPISRNLTNEIFNLARKYSPESKEEHKARLLQIADAKANGKPLPEKSDKLVIASGIRRITSLVESKRAKLVLIANDVDPLELVLWLPTLCHKMGVPYAIVRTKGDLGKLVHLKKTTSVCFTDVNPEDKPTFDKILAAVAHEVDYAKAMKTYGGGVRREDEAQQM

Entity 10 Entity 10 polymer

Description description	Ribosomal protein L6
Molecular weight formula_weight	20889.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MPLCSSMTIKVPTDVECTINKRVVTVKGKKGTLVRDFSHAPLDITHANDTISVAVWFPRGKRNALPRTICSHIENMFKGVTYGFEYKMRLAYAHFPIAATVVDNNKAIEIRNFMHQIKTRRIECLPGVTIAMSTNVKDELILRGISIEDVSHTAARIHESLKVPNKDLRKFLDGCYVSSRGLQEQ

Entity 11 Entity 11 polymer

Description description	Ribosomal protein L10
Molecular weight formula_weight	24283.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MGRRPARCYRYQKNKPYPKSRFCRGVPDPKIRYFDLGNRRAKVNDFPYCFHLLSGEKEQVSSEALEACRIACNKYIAKKAGKDSFHLRIRVHPFHVIRINKMLSCAGADRLQTGMRGAWGKPQGTVARVSIGQPLLSVRCRASAKDYVKDALRRAKFKIPGRQAIVESRNWGFTEFTKEEYEDLRERGELQYDGNNAHRISRKGPLNLKL

Entity 12 Entity 12 polymer

Description description	Ribosomal protein L11
Molecular weight formula_weight	19767.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MSQESENPMRRIRIEKLVLNICIGGEGDALTKAAKVLQQLTDQEPTFSKSRLTIRGFGIRRGQKISTHVTVRGEKAREIIERGLRVKNFELPYSCFSTTGNFGFGITEHIDLGIKYDPSMGIYGMDFYVVLSRPGFRVNKRRAQQQHVGASHKITPDEARAWVEREFEVVYTK

Entity 13 Entity 13 polymer

Description description	60S ribosomal protein L13
Molecular weight formula_weight	26640.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MASYASFILRLIHFNLNFVTAFCPLPRAMGRNVAFSNMRRYKCTNKGPNLIKNWFNQPARKIRRRQTRLQKAKAIFPCPLQKLRPSVTRCSQKFNLTQRIGRGFTLRELQGVGLSAGKARQIGIAVDPRRKNKSEESVARNVARLKEYLSKVTIFSKQAKPEEIQQAIQHQGVVMPVVNPKPVITTGSIAEAKKEVPENLFMYLRNARTARNRARLAKRDAEREAAAKTKGGKK

Entity 14 Entity 14 polymer

Description description	Ribosomal protein L14
Molecular weight formula_weight	14785.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MSYHRFVEAGRLVYLGDGPDKGKLAVIVDILSTAAVLIDGPTTGVKRQVVSLRWAMLTDQVINISEKPTTEQLKKEIEASPAIDTFMNSVWGKKIQQQRLRAKATFEDMGKIAKLRRERKMAMKRIAMSIK

Entity 15 Entity 15 polymer

Description description	Ribosomal protein L15
Molecular weight formula_weight	24353.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MGAYKYVQELWRKKQSEALHYLFRLRTWEYRQLNAIKRCSHPTRPEKARRLGYKAKRGYVVYRVRVRRGGRKRQCVHGISYGKPRNIGIVGLKPSRSLRALAEQKVGRRLPSLRVLNSYWVAQDGSYKWYEVILIDPFHPWIRNDPKINWICNPVMKRRECRGLTSAGRKARGLHNKGIGAMKLRPSKRAAWKRNHTRSLRRYR

Entity 16 Entity 16 polymer

Description description	Ribosomal protein L13a
Molecular weight formula_weight	22921.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MSRIVIDCKGHILGRLSAIVAKELLHGHEVALVRCEKAIISGAFRDVKAHYLKKMHKRTNFNHLRGPFHFRAPAEIVRRTIRGMIPYKTVRGSDAMSRLRVYDGIPPCCARYKRVVCPSAMAYLCLRPERRRCEVGRVAHEIGWQHAADVERYEKRRLEECDKWYQDKIQIDKKIAEAAEKDAELQRINAELAKYGY

Entity 17 Entity 17 polymer

Description description	Ribosomal protein L17
Molecular weight formula_weight	18722.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MVKYAFKSDNLLVGKSRRDGVKASFKNTYSTCRAIKGMGVKRAFAYLDNVLNHKEIVPFFKFYKGVGRHSQARGSGTDKGRWPEKSVVVVKDILKQAVSNAKHAHKKEEDELYVISYCVNRARGRRRRTFRAHGRISKYESQPCHVELIVGPKPLDVEKAKALQ

Entity 18 Entity 18 polymer

Description description	Ribosomal protein L18
Molecular weight formula_weight	20207.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MGIDLKTGIKKRKVERKEPKSPNPYIRLLHNAFKVVYENTGEDFTKVLTKRLCLSKTNRPVLSVSRLAHLMHKREDKIAVVASTVTNDERLVTIPRMTICALKFSATARSRIEKAGGRCMSFDELLAEKPTGDNCVLLQGRRSCRAVCKKFGSPGRPNSHVKPKGEHKGRRGARGRHSW

Entity 19 Entity 19 polymer

Description description	Ribosomal protein L19
Molecular weight formula_weight	23199.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MANLRLQKRLAADVLKCGKRRVRFNPAHEKYIEQASSREAIRSLIESKIIAKLDIKGSSRGRIRARHAAKRLGRHSGHGKRRGTREARMPSKTLWIQRQRVLRRLLSRYRDDEKIDRHLYETLYAKAKGNMFKNKRVLLEHIVGMQKEQELEKKKKEELEQRRKKAEQRCKERAEKVAANRLAFAQTGIFTEKTNK

Entity 20 Entity 20 polymer

Description description	60S ribosomal protein L18a
Molecular weight formula_weight	20624.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MMQKYIVYGRRLPSEKFPEPEVFRMTIYAPNEIVAKSRFWYHLKSLKKIKRTHGEILDCQHIEENGDFVKNFGVLLRYRSRVGQHNMYREVRETTSARAMDKVYSEMAGQCRARYHDIQIINVKEVADEDVRREKVAMFTQKGVRFPHPCPYVHVKRAARTARFQDRAPHVPQ

Entity 21 Entity 21 polymer

Description description	Ribosomal protein L21
Molecular weight formula_weight	18296.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MTHSQGYRCKTRYCFARKFRRHGMANLTTYNRVYKLGQYVNIKVNGAYHKGMPHRYYNGRTGTIFNIGPRALGVQIQKRVRGRIMLKRINVRLEHVHPSDCRKNHLERVAANDAARRLAKETGQPVPCLKRQNALPRAAHVVSIASAIDITPLKYDGVF

Entity 22 Entity 22 polymer

Description description	Ribosomal protein eL22
Molecular weight formula_weight	19942.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MEGQWILFPDQIVNHLCRHADHRLQARVSSKSNLKSNYAYYFSPSSEMRPRIKKCVKKEQGNIRFAVDCSAGKDLELNLNEFADYVRTHFKINNRKHGVAEKVACSVEGDSLVIQTTGYEFAKRYVKYLTKRFLYQDYQGVFRVLSTDKETYTLKPYTIEDDDDEAGTDDE

Entity 23 Entity 23 polymer

Description description	Ribosomal protein L23
Molecular weight formula_weight	15450.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MASKRGRSGGIGNKFRISCGLPVGAVINCADNSGAKSLNMIAVKNWKGHLNRFPKASVGDMVLITVGRDGKPELRRKVTPAVVVRQRKVWRRKDGVWIYFQDNAGVIINPKGELKGSSITGPVAKEAADRWPKISTTAECVH

Entity 24 Entity 24 polymer

Description description	Ribosomal protein L23A
Molecular weight formula_weight	16053.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MSEKAQALKAQKAILHGTRVEAKKIRTNVHFFRPKTLVHKKAPLYPRNPIKKGSWDDPCDLLRYPIKTDENTTQIEKNNTIVFIVDRRASKPEIRKAFETVFETKVARVNTLITPLGLKKAFIRLAPDVQAMDVASKMGLA

Entity 25 Entity 25 polymer

Description description	Ribosomal protein L26
Molecular weight formula_weight	15621.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MKLNSAVTASRRKCRKAYFTANAETRAKMMSSRLSKELRAEHKIKTMPIRRGDIVEIFTGGHKGTGKVVEVRRRDYKICVEGINQKARNPEAKPVPYPIHPSNCIIKELYMNGSRYRAIKRRQERNAERLARIGK

Entity 26 Entity 26 polymer

Description description	60S ribosomal protein L27
Molecular weight formula_weight	15374.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MSQPIIKPGLVCIVLQGRHAGKKAVIVEALPHNERGSYAIVAGIAALPRRITNSMSDEEAVCRGRVRSFVKCMNVNHLMPTSCRLENNYKDFISTQTVADVTKRREIIETVNKDFQRRILEHRDTWFFTKLPIDA

Entity 27 Entity 27 polymer

Description description	Ribosomal protein L27a
Molecular weight formula_weight	17167.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MPTRIRKSRKRRGHRQMGYGRVGGHRKHPSGRGKAGGLQHKRTSFDKYHPGYFGKLGMRNYHVRRNIEYNPTINIDKIWSLIPEEQRDGFLQRKSTTEAPVVDVTRFGFFKVLGRGSLPQCPIIIKARYFSSDAEKKLREVGGVPLLVP

Entity 28 Entity 28 polymer

Description description	60S ribosomal protein L29
Molecular weight formula_weight	7363.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MAKLKNHTSKNQNRKDHRNGIKKPKKSAYTSHKGMCPKYLRNLRRSRANDPRQSLRPNLNKE

Entity 29 Entity 29 polymer

Description description	Ribosomal protein L30
Molecular weight formula_weight	11698.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MSTKVATKKAQDSISLTLTLVVKSGKYTLGTDQAIRNIRDGKAQLVFMANNCPPLVKSQVDYLCHLSKTPVRVFAGSSRELGIAVGRQFNVSIMTILEAGDADLTSILG

Entity 30 Entity 30 polymer

Description description	Ribosomal protein L31B
Molecular weight formula_weight	12184.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MGIVYEHTIRLNKAVRGKPSKKAAPIAIRAIRAQVEKLAKVEDVRLDPSVNVFVWSRGIRHVPRRIRLEVRLEGDDEHKFAYVINKDVENFKHLTTEKKGSEDGSE

Entity 31 Entity 31 polymer

Description description	Ribosomal protein L32
Molecular weight formula_weight	15986.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

MAGEMIHPLPHKIIIKKRKNKFIRFQSERFVRVKPSWRKPRGIDSPMRHQYRGQRPMVSIGYGSDKETRFMLPCGFFKHRISTVHELKTLFMNNKTHAAQIAHGVSARSRKQILEEAKKMGVRVLNADAKLRKEEL

Entity 32 Entity 32 polymer

Description description	Ribosomal protein L35a
Molecular weight formula_weight	13913.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

MEEIKGKTFLPAIFVGYQRSRAKQRENVALVKVSGIYTRAETDKVLGRLIAIIHSKSGKPIFGKICRPHGNSGMVRARFYTNLPGQLMGHKVRVFYDNIDVGDRATPKYERLYGNPNATVTYE

Entity 33 Entity 33 polymer

Description description	Ribosomal protein L34
Molecular weight formula_weight	13528.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g

MADCRVTCRFHSTYRTRSKIVRYKRTPGNRLTSLRVKKLPNAPHCAETGKQIHGIPRVIPQHLTRQQRKVSRPYGGKLCGSALRAHILESFLNEENQALREIAAQTAKTAKQTAGKGHAK

Entity 34 Entity 34 polymer

Description description	Ribosomal protein L29
Molecular weight formula_weight	14292.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

MPGLKAKDLVGLSQEDLQRKLADLKRELLSLRTMKATAGPVPERIARFRVCKKDVARVLTVINQKARDEARAAFEGAEHIPKTFRPRLTHAMRCQLTEKQKRLLPSKLMKRKLQFPKLKYAVKV

Entity 35 Entity 35 polymer

Description description	Ribosomal protein L36-1
Molecular weight formula_weight	10586.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

MPGKVFNLKKGGAVVRIVRKKEERKTKPHQEFVKSIIQECTGMAPYEMHIIELLRMNKDRHALRYAKKRLGNIKRAKAKRDQLSVYARNI

Entity 36 Entity 36 polymer

Description description	Ribosomal protein L37
Molecular weight formula_weight	10329.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

MSKGTASFGKRHTRIHGSCRRCGKHSFHLQKHECASCGYPSAKMRRYNWSYKSLRRRTQGTGSMSHMRKVYRAYNSGTLKANARKYLAK

Entity 37 Entity 37 polymer

Description description	Ribosomal L38e
Molecular weight formula_weight	8605.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

MPNTITEENLMKMIADGRGKKLVVKSCSKGRLQGKVKLKLRTAKYLYTLTVPNADDAKSIVKGCKDKVEVQYVNDSE

Entity 38 Entity 38 polymer

Description description	Ribosomal protein L39
Molecular weight formula_weight	6353.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l

MTANKTLSRKLRLAKKTKTNKNIPRWVIAKDHLKKTWNYKRHHWRRSHLKL

Entity 39 Entity 39 polymer

Description description	Ubiquitin/Ribosomal protein L40e
Molecular weight formula_weight	14343.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m

MQLIVRSLDRTVALTASPADSLTSIRQRLLAVYSGHVVDSQRFVFAGRTLDEAKTLGDYSIGESSVLDLVPRLFGGVMEPTLINLAREYNQNMMICRHCYARNPLRATNCRRCRGTNLRKKKLSKYA

Entity 40 Entity 40 polymer

Description description	Ribosomal protein L44
Molecular weight formula_weight	12311.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o

MVTYPAERRTFCKREGKHTVHKASLYKKGKDSLLAQGKRRYDRKQRGFGGQTKPIFRRKAKTTKKQVIRLTCSSCKCQTFQVLKRCHRLEISRLGATKKSKGSVVF

Entity 41 Entity 41 polymer

Description description	Ribosomal protein L37a
Molecular weight formula_weight	10508.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p

MAKRTKKVGLTGKYGTRYGRAARKQLLKIETSQKAKYTCPFCAKDKVRRTACGIWTCRSCSKTMAGGAYSLHTEPANAARATIRRLRLAREDAQ

Entity 42 Entity 42 polymer

Description description	E-site tRNA
Molecular weight formula_weight	24500.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	w

AGCGGGUUAGCUCAGUCGGUAGAGCGUCAGUCUGAUAAGCUGAAGGUCGGGGGUUUUCGAGCCCCCCCCGCCACCA

Entity 43 Entity 43 polymer

Description description	Ribosomal protein L24A
Molecular weight formula_weight	12005.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MVTTNQCSYSGRKILPGYGKRMSRHDKVLLIFLNRKASVHYLNKWNPRKIRWTLASRRARGKEVIVKARERVTRKAVVSKRNFLSIDDSKLEALKSKYSRVN

Entity 44 Entity 44 polymer

Description description	P-site tRNA
Molecular weight formula_weight	894.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	E

CCA

Entity 45 Entity 45 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	112

Entity 46 Entity 46 non-polymer

Description description	POTASSIUM ION
Molecular weight formula_weight	39.1 kDa
Source method src_method	syn
Copy count entity_count	181

Entity 47 Entity 47 non-polymer

Description description	TRIETHYLENE GLYCOL
Molecular weight formula_weight	150.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 48 Entity 48 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	4397

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	2.75 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	91058

Cryo-EM structure of large subunit of Giardia lamblia ribosome at 2.7 A resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ribosomal protein L2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribosomal protein L3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribosomal protein L4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribosomal protein L5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribosomal protein L7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

60S ribosomal protein L7a

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribosomal protein L6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribosomal protein L10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribosomal protein L11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

60S ribosomal protein L13

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer