SAXSdb — 7rd1

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Pre-protein VI

Chimpanzee adenovirus Y25

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 1920	Hexon protein × 720 （G9G854） Penton protein × 60 （G9G849） Hexon-interlacing protein × 240 （G9G843） Pre-hexon-linking protein IIIa × 60 （G9G848） Pre-hexon-linking protein VIII × 120 （G9G860）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 32	Hexon protein × 12 （G9G854） Penton protein × 1 （G9G849） Hexon-interlacing protein × 4 （G9G843） Pre-hexon-linking protein IIIa × 1 （G9G848） Pre-hexon-linking protein VIII × 2 （G9G860）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 160	Hexon protein × 60 （G9G854） Penton protein × 5 （G9G849） Hexon-interlacing protein × 20 （G9G843） Pre-hexon-linking protein IIIa × 5 （G9G848） Pre-hexon-linking protein VIII × 10 （G9G860）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 192	Hexon protein × 72 （G9G854） Penton protein × 6 （G9G849） Hexon-interlacing protein × 24 （G9G843） Pre-hexon-linking protein IIIa × 6 （G9G848） Pre-hexon-linking protein VIII × 12 （G9G860）	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 32	Hexon protein × 12 （G9G854） Penton protein × 1 （G9G849） Hexon-interlacing protein × 4 （G9G843） Pre-hexon-linking protein IIIa × 1 （G9G848） Pre-hexon-linking protein VIII × 2 （G9G860）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G9G853_9ADEN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 0； PDBConstruct 1–243； UniProt 1–243 Author chain 1； PDBConstruct 1–243； UniProt 1–243 Author chain 2； PDBConstruct 1–243； UniProt 1–243 Author chain 3； PDBConstruct 1–243； UniProt 1–243 Author chain 4； PDBConstruct 1–243； UniProt 1–243 Author chain 8； PDBConstruct 1–243； UniProt 1–243 Author chain U； PDBConstruct 1–243； UniProt 1–243 Author chain V； PDBConstruct 1–243； UniProt 1–243 Author chain W； PDBConstruct 1–243； UniProt 1–243 Author chain X； PDBConstruct 1–243； UniProt 1–243 Author chain Y； PDBConstruct 1–243； UniProt 1–243 Author chain Z； PDBConstruct 1–243； UniProt 1–243

Hexon protein

Chimpanzee adenovirus Y25

UniProt G9G854

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 1920	Pre-protein VI × 720 （G9G853） Penton protein × 60 （G9G849） Hexon-interlacing protein × 240 （G9G843） Pre-hexon-linking protein IIIa × 60 （G9G848） Pre-hexon-linking protein VIII × 120 （G9G860）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 32	Pre-protein VI × 12 （G9G853） Penton protein × 1 （G9G849） Hexon-interlacing protein × 4 （G9G843） Pre-hexon-linking protein IIIa × 1 （G9G848） Pre-hexon-linking protein VIII × 2 （G9G860）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 160	Pre-protein VI × 60 （G9G853） Penton protein × 5 （G9G849） Hexon-interlacing protein × 20 （G9G843） Pre-hexon-linking protein IIIa × 5 （G9G848） Pre-hexon-linking protein VIII × 10 （G9G860）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 192	Pre-protein VI × 72 （G9G853） Penton protein × 6 （G9G849） Hexon-interlacing protein × 24 （G9G843） Pre-hexon-linking protein IIIa × 6 （G9G848） Pre-hexon-linking protein VIII × 12 （G9G860）	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 32	Pre-protein VI × 12 （G9G853） Penton protein × 1 （G9G849） Hexon-interlacing protein × 4 （G9G843） Pre-hexon-linking protein IIIa × 1 （G9G848） Pre-hexon-linking protein VIII × 2 （G9G860）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G9G854_9ADEN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–942； UniProt 1–942 Author chain B； PDBConstruct 1–942； UniProt 1–942 Author chain C； PDBConstruct 1–942； UniProt 1–942 Author chain D； PDBConstruct 1–942； UniProt 1–942 Author chain E； PDBConstruct 1–942； UniProt 1–942 Author chain F； PDBConstruct 1–942； UniProt 1–942 Author chain G； PDBConstruct 1–942； UniProt 1–942 Author chain H； PDBConstruct 1–942； UniProt 1–942 Author chain I； PDBConstruct 1–942； UniProt 1–942 Author chain J； PDBConstruct 1–942； UniProt 1–942 Author chain K； PDBConstruct 1–942； UniProt 1–942 Author chain L； PDBConstruct 1–942； UniProt 1–942

Penton protein

Chimpanzee adenovirus Y25

UniProt G9G849

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 1920	Pre-protein VI × 720 （G9G853） Hexon protein × 720 （G9G854） Hexon-interlacing protein × 240 （G9G843） Pre-hexon-linking protein IIIa × 60 （G9G848） Pre-hexon-linking protein VIII × 120 （G9G860）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 32	Pre-protein VI × 12 （G9G853） Hexon protein × 12 （G9G854） Hexon-interlacing protein × 4 （G9G843） Pre-hexon-linking protein IIIa × 1 （G9G848） Pre-hexon-linking protein VIII × 2 （G9G860）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 160	Pre-protein VI × 60 （G9G853） Hexon protein × 60 （G9G854） Hexon-interlacing protein × 20 （G9G843） Pre-hexon-linking protein IIIa × 5 （G9G848） Pre-hexon-linking protein VIII × 10 （G9G860）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 192	Pre-protein VI × 72 （G9G853） Hexon protein × 72 （G9G854） Hexon-interlacing protein × 24 （G9G843） Pre-hexon-linking protein IIIa × 6 （G9G848） Pre-hexon-linking protein VIII × 12 （G9G860）	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 32	Pre-protein VI × 12 （G9G853） Hexon protein × 12 （G9G854） Hexon-interlacing protein × 4 （G9G843） Pre-hexon-linking protein IIIa × 1 （G9G848） Pre-hexon-linking protein VIII × 2 （G9G860）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G9G849_9ADEN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain M； PDBConstruct 1–532； UniProt 1–532

Hexon-interlacing protein

Chimpanzee adenovirus Y25

UniProt G9G843

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 1920	Pre-protein VI × 720 （G9G853） Hexon protein × 720 （G9G854） Penton protein × 60 （G9G849） Pre-hexon-linking protein IIIa × 60 （G9G848） Pre-hexon-linking protein VIII × 120 （G9G860）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 32	Pre-protein VI × 12 （G9G853） Hexon protein × 12 （G9G854） Penton protein × 1 （G9G849） Pre-hexon-linking protein IIIa × 1 （G9G848） Pre-hexon-linking protein VIII × 2 （G9G860）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 160	Pre-protein VI × 60 （G9G853） Hexon protein × 60 （G9G854） Penton protein × 5 （G9G849） Pre-hexon-linking protein IIIa × 5 （G9G848） Pre-hexon-linking protein VIII × 10 （G9G860）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 192	Pre-protein VI × 72 （G9G853） Hexon protein × 72 （G9G854） Penton protein × 6 （G9G849） Pre-hexon-linking protein IIIa × 6 （G9G848） Pre-hexon-linking protein VIII × 12 （G9G860）	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 32	Pre-protein VI × 12 （G9G853） Hexon protein × 12 （G9G854） Penton protein × 1 （G9G849） Pre-hexon-linking protein IIIa × 1 （G9G848） Pre-hexon-linking protein VIII × 2 （G9G860）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G9G843_9ADEN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain N； PDBConstruct 1–142； UniProt 1–142 Author chain O； PDBConstruct 1–142； UniProt 1–142 Author chain P； PDBConstruct 1–142； UniProt 1–142 Author chain Q； PDBConstruct 1–142； UniProt 1–142

Pre-hexon-linking protein IIIa

Chimpanzee adenovirus Y25

UniProt G9G848

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 1920	Pre-protein VI × 720 （G9G853） Hexon protein × 720 （G9G854） Penton protein × 60 （G9G849） Hexon-interlacing protein × 240 （G9G843） Pre-hexon-linking protein VIII × 120 （G9G860）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 32	Pre-protein VI × 12 （G9G853） Hexon protein × 12 （G9G854） Penton protein × 1 （G9G849） Hexon-interlacing protein × 4 （G9G843） Pre-hexon-linking protein VIII × 2 （G9G860）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 160	Pre-protein VI × 60 （G9G853） Hexon protein × 60 （G9G854） Penton protein × 5 （G9G849） Hexon-interlacing protein × 20 （G9G843） Pre-hexon-linking protein VIII × 10 （G9G860）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 192	Pre-protein VI × 72 （G9G853） Hexon protein × 72 （G9G854） Penton protein × 6 （G9G849） Hexon-interlacing protein × 24 （G9G843） Pre-hexon-linking protein VIII × 12 （G9G860）	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 32	Pre-protein VI × 12 （G9G853） Hexon protein × 12 （G9G854） Penton protein × 1 （G9G849） Hexon-interlacing protein × 4 （G9G843） Pre-hexon-linking protein VIII × 2 （G9G860）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G9G848_9ADEN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain R； PDBConstruct 1–589； UniProt 1–589

Pre-hexon-linking protein VIII

Chimpanzee adenovirus Y25

UniProt G9G860

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 1920	Pre-protein VI × 720 （G9G853） Hexon protein × 720 （G9G854） Penton protein × 60 （G9G849） Hexon-interlacing protein × 240 （G9G843） Pre-hexon-linking protein IIIa × 60 （G9G848）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 32	Pre-protein VI × 12 （G9G853） Hexon protein × 12 （G9G854） Penton protein × 1 （G9G849） Hexon-interlacing protein × 4 （G9G843） Pre-hexon-linking protein IIIa × 1 （G9G848）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 160	Pre-protein VI × 60 （G9G853） Hexon protein × 60 （G9G854） Penton protein × 5 （G9G849） Hexon-interlacing protein × 20 （G9G843） Pre-hexon-linking protein IIIa × 5 （G9G848）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 192	Pre-protein VI × 72 （G9G853） Hexon protein × 72 （G9G854） Penton protein × 6 （G9G849） Hexon-interlacing protein × 24 （G9G843） Pre-hexon-linking protein IIIa × 6 （G9G848）	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 32	Pre-protein VI × 12 （G9G853） Hexon protein × 12 （G9G854） Penton protein × 1 （G9G849） Hexon-interlacing protein × 4 （G9G843） Pre-hexon-linking protein IIIa × 1 （G9G848）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G9G860_9ADEN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain S； PDBConstruct 1–227； UniProt 1–227 Author chain T； PDBConstruct 1–227； UniProt 1–227

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7rd1
Deposition date deposition_date	2021-07-08
Structure title title	The Capsid Structure of the ChAdOx1 viral vector/chimpanzee adenovirus Y25
Keywords keywords	;Adenovirus, simian adenovirus, chimpanzee adenovirus, vaccine vector, DNA virus, AdV, ChAdV-Y25, adenovirus Y25, Y25, viral vector, ChAdOx1, chimp Ad, dsDNA virus, icosahedral, chimpanzee adenovirus Y25, Y-25, Y 25, ChAdV, VIRUS ;; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7rd1__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7rd1__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7rd1__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	379.20 Å
Total Rg	379.20 Å
Atom count	11866920
Residues	766380
Excluded volume	106980000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7rd1__assembly_1__model_1`	1920-meric （1920）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`7rd1__assembly_2__model_1`	32-meric （32）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`7rd1__assembly_3__model_1`	160-meric （160）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
4	1	`7rd1__assembly_4__model_1`	192-meric （192）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
5	1	`7rd1__assembly_5__model_1`	32-meric （32）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Pre-protein VI
Molecular weight formula_weight	26299.7 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0,U,1,V,2,W,3,X,4,Y,8,Z
Atom count atom_count	197782

MEDINFSSLAPRHGTRPFMGTWSDIGTSQLNGGAFNWSSLWSGLKNFGSTLKTYGSKAWNSTTGQALRDKLKEQNFQQKVVDGLASGINGVVDLANQAVQRQINSRLDPVPPAGSVEMPQVEEELPPLDKRGEKRPRPDAEETLLTHTDEPPPYEEAVKLGLPTTRPIAPLATGVLKPESNKPATLDLPPPASRPSTVAKPLPPVAVARARPGGSARPHANWQSTLNSIVGLGVQSVKRRRCY

Source Source

Source organism organism	Chimpanzee adenovirus Y25
NCBI taxonomy ID ncbi_taxonomy_id	1123958
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Hexon protein
Molecular weight formula_weight	106121.1 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L

MATPSMLPQWAYMHIAGQDASEYLSPGLVQFARATDTYFSLGNKFRNPTVAPTHDVTTDRSQRLTLRFVPVDREDNTYSYKVRYTLAVGDNRVLDMASTYFDIRGVLDRGPSFKPYSGTAYNSLAPKGAPNSSQWEQKKAGNGDTMETHTFGVAPMGGENITIDGLQIGTDATADQDKPIYADKTFQPEPQVGEENWQETESFYGGRALKKDTSMKPCYGSYARPTNVKGGQAKLKVGADGVPTKEFDIDLAFFDTPGGTVNGQDEYKADIVMYTENTYLETPDTHVVYKPGKDDASSEINLVQQSMPNRPNYIGFRDNFIGLMYYNSTGNMGVLAGQASQLNAVVDLQDRNTELSYQLLLDSLGDRTRYFSMWNQAVDSYDPDVRIIENHGVEDELPNYCFPLDGSGTNAAYQGVKVKNGNDGDVESEWENDDTVAARNQLCKGNIFAMEINLQANLWRSFLYSNVALYLPDSYKYTPANITLPTNTNTYDYMNGRVVPPSLVDAYINIGARWSLDPMDNVNPFNHHRNAGLRYRSMLLGNGRYVPFHIQVPQKFFAIKSLLLLPGSYTYEWNFRKDVNMILQSSLGNDLRTDGASISFTSINLYATFFPMAHNTASTLEAMLRNDTNDQSFNDYLSAANMLYPIPANATNVPISIPSRNWAAFRGWSFTRLKTKETPSLGSGFDPYFVYSGSIPYLDGTFYLNHTFKKVSITFDSSVSWPGNDRLLTPNEFEIKRTVDGEGYNVAQCNMTKDWFLVQMLAHYNIGYQGFYVPEGYKDRMYSFFRNFQPMSRQVVDEVNYKDYQAVTLAYQHNNSGFVGYLAPTMRQGQPYPANYPYPLIGKSAVTSVTQKKFLCDRVMWRIPFSSNFMSMGALTDLGQNMLYANSAHALDMNFEVDPMDESTLLYVVFEVFDVVRVHQPHRGVIEAVYLRTPFSAGNATT

Source Source

Source organism organism	Chimpanzee adenovirus Y25
NCBI taxonomy ID ncbi_taxonomy_id	1123958
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	Penton protein
Molecular weight formula_weight	59533.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MMRRAYPEGPPPSYESVMQQAMAAAAAMQPPLEAPYVPPRYLAPTEGRNSIRYSELAPLYDTTRLYLVDNKSADIASLNYQNDHSNFLTTVVQNNDFTPTEASTQTINFDERSRWGGQLKTIMHTNMPNVNEFMYSNKFKARVMVSRKTPNGVTVTDGSQDILEYEWVEFELPEGNFSVTMTIDLMNNAIIDNYLAVGRQNGVLESDIGVKFDTRNFRLGWDPVTELVMPGVYTNEAFHPDIVLLPGCGVDFTESRLSNLLGIRKRQPFQEGFQIMYEDLEGGNIPALLDVDAYEKSKEESAAAATAAVATASTEVRGDNFASPAAVAAAEAAETESKIVIQPVEKDSKDRSYNVLPDKINTAYRSWYLAYNYGDPEKGVRSWTLLTTSDVTCGVEQVYWSLPDMMQDPVTFRSTRQVSNYPVVGAELLPVYSKSFFNEQAVYSQQLRAFTSLTHVFNRFPENQILVRPPAPTITTVSENVPALTDHGTLPLRSSIRGVQRVTVTDARRRTCPYVYKALGIVAPRVLSSRTF

Source Source

Source organism organism	Chimpanzee adenovirus Y25
NCBI taxonomy ID ncbi_taxonomy_id	1123958
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	Hexon-interlacing protein
Molecular weight formula_weight	14468.1 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N,O,P,Q

MSGSGSFEGGVFSPYLTGRLPSWAGVRQNVMGSTVDGRPVQPANSSTLTYATLSSSSVDAAAAAAAASAASAVRGMAMGAGYYGTLVANSSSTNNPASLNEEKLLLLMAQLEALTQRLGELTQQVAQLQEQTRAAVATVKSK

Source Source

Source organism organism	Chimpanzee adenovirus Y25
NCBI taxonomy ID ncbi_taxonomy_id	1123958
Host organism host_organism	Homo sapiens

Entity 5 Entity 5 polymer

Description description	Pre-hexon-linking protein IIIa
Molecular weight formula_weight	65954.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MQQQPPPDPAMRAALQSQPSGINSSDDWTQAMQRIMALTTRNPEAFRQQPQANRLSAILEAVVPSRSNPTHEKVLAIVNALVENKAIRGDEAGLVYNALLERVARYNSTNVQTNLDRMVTDVREAVAQRERFHRESNLGSMVALNAFLSTQPANVPRGQEDYTNFISALRLMVTEVPQSEVYQSGPDYFFQTSRQGLQTVNLSQAFKNLQGLWGVQAPVGDRATVSSLLTPNSRLLLLLVAPFTDSGSINRNSYLGYLINLYREAIGQAHVDEQTYQEITHVSRALGQDDPGNLEATLNFLLTNRSQKIPPQYTLSAEEERILRYVQQSVGLFLMQEGATPSAALDMTARNMEPSMYASNRPFINKLMDYLHRAAAMNSDYFTNAILNPHWLPPPGFYTGEYDMPDPNDGFLWDDVDSSVFSPRPGANERPLWKKEGSDRRPSSALSGREGAAAAVPEAASPFPSLPFSLNSIRSSELGRITRPRLLGEEEYLNDSLLRPEREKNFPNNGIESLVDKMSRWKTYAQEHRDDPSQGATSRGSAARKRRWHDRQRGLMWDDEDSADDSSVLDLGGSGNPFAHLRPRIGRMM

Source Source

Source organism organism	Chimpanzee adenovirus Y25
NCBI taxonomy ID ncbi_taxonomy_id	1123958
Host organism host_organism	Homo sapiens

Entity 6 Entity 6 polymer

Description description	Pre-hexon-linking protein VIII
Molecular weight formula_weight	24779.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,T

MSKEIPTPYMWSYQPQMGLAAGAAQDYSTRMNWLSAGPAMISRVNDIRAHRNQILLEQSALTATPRNHLNPRNWPAALVYQEIPQPTTVLLPRDAQAEVQLTNSGVQLAGGATLCRHRPAQGIKRLVIRGRGTQLNDEVVSSSLGLRPDGVFQLAGSGRSSFTPRQAVLTLESSSSQPRSGGIGTLQFVEEFTPSVYFNPFSGSPGHYPDEFIPNFDAISESVDGYD

Source Source

Source organism organism	Chimpanzee adenovirus Y25
NCBI taxonomy ID ncbi_taxonomy_id	1123958
Host organism host_organism	Homo sapiens

▶

Resolution resolution	3.07 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	5748

The Capsid Structure of the ChAdOx1 viral vector/chimpanzee adenovirus Y25

1. Protein Identity and Related Structures Protein Identity & Related Structures

Pre-protein VI

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Hexon protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Penton protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Hexon-interlacing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-hexon-linking protein IIIa

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-hexon-linking protein VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7rd1__assembly_1__model_1

7rd1__assembly_1__model_1 | I(q)

7rd1__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 polymer

Polymer Polymer

Source Source

7. Citations (2)