SAXSdb — 7rec

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Calcium/calmodulin-dependent protein kinase type II subunit alpha

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 14 PDB declaration: tetradecameric（14） Consistent with protein copy count	Chain A； UniProt 345–475 Chain B； UniProt 345–475 Chain C； UniProt 345–475 Chain D； UniProt 345–475 Chain E； UniProt 345–475 Chain F； UniProt 345–475 Chain G； UniProt 345–475	Fragment：hub (UNP residues 345-475) Mutation：T354N, E355Q, T412N, I414M, I464H, F467M	7ZV 5-hydroxydiclofenac × 12 NA SODIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；100 nL protein + compound in 25 mM Tris, 150 mM potassium chloride, 2 mM DTT, 1 mM TCEP, 10% v/v glycerol, pH 8.0, 10% DMSO + 100 nL well solution (200 mM potassium acetate, 20% w/v PEG3350, pH 8.1), equilibrated against 45 uL well solution	Resolution 2.20 Å R-free 0.244

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7REC	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2VZ6 Structure of human calcium calmodulin dependent protein kinase type II alpha (CAMK2A) in complex with Indirubin E804 Deposited 2008-07-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 13–302（290 aa） Fragment：KINASE DOMAIN, RESIDUES 13-302	Not recorded	FEF (2Z,3E)-2,3'-BIINDOLE-2',3(1H,1'H)-DIONE 3-{O-[(3R)-3,4-DIHYDROXYBUTYL]OXIME} × 1 PGO S-1,2-PROPANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；12% PEG6000, 0.1M TRIS PH8.5	Resolution 2.30 Å R-free 0.203
2VZ6 Structure of human calcium calmodulin dependent protein kinase type II alpha (CAMK2A) in complex with Indirubin E804 Deposited 2008-07-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 13–302（290 aa） Fragment：KINASE DOMAIN, RESIDUES 13-302	Not recorded	FEF (2Z,3E)-2,3'-BIINDOLE-2',3(1H,1'H)-DIONE 3-{O-[(3R)-3,4-DIHYDROXYBUTYL]OXIME} × 1 PGO S-1,2-PROPANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；12% PEG6000, 0.1M TRIS PH8.5	Resolution 2.30 Å R-free 0.203
3SOA Full-length human CaMKII Deposited 2011-06-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 1–474（474 aa）	Mutation：K42M, D135N, T306V	DB8 4-[(2,4-dichloro-5-methoxyphenyl)amino]-6-methoxy-7-[3-(4-methylpiperazin-1-yl)propoxy]quinoline-3-carbonitrile × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.5；288.15 K；1.2 M Ammonium Tartrate, 100 mM bistrispropane, pH 5.5, VAPOR DIFFUSION, temperature 288.15K	Resolution 3.55 Å R-free 0.327
5IG3 Crystal structure of the human CaMKII-alpha hub Deposited 2016-02-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 345–475（131 aa） Fragment：UNP residues 345-475 Chain B 345–475（131 aa） Fragment：UNP residues 345-475 Chain C 345–475（131 aa） Fragment：UNP residues 345-475 Chain D 345–475（131 aa） Fragment：UNP residues 345-475 Chain E 345–475（131 aa） Fragment：UNP residues 345-475 Chain F 345–475（131 aa） Fragment：UNP residues 345-475	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.3；295 K；35 % (v/v) MPD, 0.1 M HEPES pH 7.3	Resolution 2.75 Å R-free 0.268
6OF8 Structure of Thr354Asn, Glu355Gln, Thr412Asn, Ile414Met, Ile464His, and Phe467Met mutant human CamKII-alpha hub domain Deposited 2019-03-28	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 14 PDB declaration: tetradecameric	Chain A 345–475（131 aa） Chain B 345–475（131 aa） Chain C 345–475（131 aa） Chain D 345–475（131 aa） Chain E 345–475（131 aa） Chain F 345–475（131 aa） Chain G 345–475（131 aa）	Mutation：T354N, E355Q, T412N, I414M, I464H, F467M Mutation：T354N, E355Q, T412N, I414M, I464H, F467M Mutation：T354N, E355Q, T412N, I414M, I464H, F467M Mutation：T354N, E355Q, T412N, I414M, I464H, F467M Mutation：T354N, E355Q, T412N, I414M, I464H, F467M Mutation：T354N, E355Q, T412N, I414M, I464H, F467M Mutation：T354N, E355Q, T412N, I414M, I464H, F467M	K POTASSIUM ION × 10 GOL GLYCEROL × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；17 mg/mL mutant hub in 25 mM Tris, 150 mM KCl, 10% (v/v) glycerol, 2 mM DTT, 1 mM TCEP, pH 8.0 was mixed 1:1 with 235 mM K3Citrate, 15% (w/v) PEG 3350, pH 8.0	Resolution 2.10 Å R-free 0.258
6VZK Crystal structure of human CaMKII-alpha (CAMK2A)kinase domain Deposited 2020-02-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 7–274（268 aa）	Mutation：D135N, Q223K	HC4 4'-HYDROXYCINNAMIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；PEG 6000, 50 mM HEPES, 3-Aminobenzene-sulfonic acid, 5-Sulfosalicylic acid dihydrate, p-Coumaric acid, PIPES, Terephthalic acid, Vanillic acid	Resolution 2.55 Å R-free 0.294
6W4O CaMKII alpha-30 Cryo-EM reconstruction Deposited 2020-03-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 13 PDB declaration: tridecameric	Chain A 7–478（472 aa） Chain B 7–478（472 aa） Chain C 7–478（472 aa） Chain D 7–478（472 aa） Chain E 7–478（472 aa） Chain F 7–478（472 aa） Chain G 7–478（472 aa） Chain I 7–478（472 aa） Chain J 7–478（472 aa） Chain K 7–478（472 aa） Chain L 7–478（472 aa） Chain M 7–478（472 aa） Chain O 7–478（472 aa）	Mutation：K37M	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.80 Å
6W4P CaMKII alpha-30 Cryo-EM reconstruction - Class B Deposited 2020-03-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 13 PDB declaration: tridecameric	Chain A 7–478（472 aa） Chain B 7–478（472 aa） Chain C 7–478（472 aa） Chain D 7–478（472 aa） Chain E 7–478（472 aa） Chain F 7–478（472 aa） Chain G 7–478（472 aa） Chain H 7–478（472 aa） Chain I 7–478（472 aa） Chain J 7–478（472 aa） Chain K 7–478（472 aa） Chain L 7–478（472 aa） Chain M 7–478（472 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.60 Å
6X5G Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and LRRC7 inhibitory domain Deposited 2020-05-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 7–274（268 aa）	Mutation：D135N, Q223K	GOL GLYCEROL × 2 BCN BICINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9；277 K；10% w/v PEG 20000, 2% v/v 1,4-Dioxane, 0.1 M Bicine	Resolution 1.85 Å R-free 0.227
6X5Q Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluA1 Deposited 2020-05-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 7–274（268 aa）	Mutation：D135N, Q223K	GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；277 K；0.1 M Tris, 28% w/v PEG 4000	Resolution 2.14 Å R-free 0.235
7KL0 Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D) Deposited 2020-10-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 7–274（268 aa）	Mutation：D135N, Q223K	UZD methyl 6-O-(heptylcarbamoyl)-beta-L-altropyranoside × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；0.1M 1,3-bis(tris(hydroxymethyl)methylamino)propane, 0.1 M Ammonium sulfate, 20% PEG 6000, 19mM HECAMEG	Resolution 2.40 Å R-free 0.258
7KL0 Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D) Deposited 2020-10-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 7–274（268 aa）	Mutation：D135N, Q223K	UZD methyl 6-O-(heptylcarbamoyl)-beta-L-altropyranoside × 1 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；0.1M 1,3-bis(tris(hydroxymethyl)methylamino)propane, 0.1 M Ammonium sulfate, 20% PEG 6000, 19mM HECAMEG	Resolution 2.40 Å R-free 0.258
7KL1 Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D) Deposited 2020-10-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 7–274（268 aa）	Mutation：D135N, Q223K	EDO 1,2-ETHANEDIOL × 1 MG MAGNESIUM ION × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；277 K；0.1M 1,3-bis(tris(hydroxymethyl)methylamino)propane, 0.1 M Ammonium sulfate, 20% PEG 6000, 19mM HECAMEG	Resolution 2.40 Å R-free 0.258
7KL1 Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D) Deposited 2020-10-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 7–274（268 aa）	Mutation：D135N, Q223K	EDO 1,2-ETHANEDIOL × 2 MG MAGNESIUM ION × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；277 K；0.1M 1,3-bis(tris(hydroxymethyl)methylamino)propane, 0.1 M Ammonium sulfate, 20% PEG 6000, 19mM HECAMEG	Resolution 2.40 Å R-free 0.258
7KL2 Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D) Deposited 2020-10-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 7–274（268 aa）	Mutation：D135N, Q223K	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；0.15 M DL-Malic acid pH 7, 20% PEG 3350	Resolution 2.56 Å R-free 0.293
7UIQ Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and Tiam1 Deposited 2022-03-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 7–274（268 aa）	Mutation：D135N, Q223K	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；0.1 M HEPES, 16% PEG 6000, 0.1% v/v Triton X-114	Resolution 3.11 Å R-free 0.309
7UIQ Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and Tiam1 Deposited 2022-03-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 7–274（268 aa）	Mutation：D135N, Q223K	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；0.1 M HEPES, 16% PEG 6000, 0.1% v/v Triton X-114	Resolution 3.11 Å R-free 0.309
7UIR Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and Tiam1 in complex with ATP Deposited 2022-03-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 7–274（268 aa）	Mutation：D135N, Q223K	EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；0.1 M HEPES, 16% PEG 6000, 0.1% v/v Triton X-114	Resolution 3.10 Å R-free 0.274
7UIR Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and Tiam1 in complex with ATP Deposited 2022-03-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 7–274（268 aa）	Mutation：D135N, Q223K	ATP ADENOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；0.1 M HEPES, 16% PEG 6000, 0.1% v/v Triton X-114	Resolution 3.10 Å R-free 0.274
7UIS Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D) Deposited 2022-03-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 7–274（268 aa）	Mutation：D135N, Q223K	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；0.1 M Bis-tris propane pH 6.5, 0.2 M Sodium chloride, 25% PEG 3350	Resolution 2.58 Å R-free 0.268
7UJP Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B Deposited 2022-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 7–274（268 aa）	Mutation：D135N, Q223K	ADP ADENOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；277 K；0.1 M Bis(2-hydroxyethyl)amino-tris(hydroxymethyl)methane, 0.1 M Ammonium sulfate, 25% PEG 3350, 19mM Methyl 6-O-(N-heptylcarbamoyl)-alpha-D-glucopyranoside	Resolution 2.56 Å R-free 0.281
7UJP Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B Deposited 2022-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 7–274（268 aa）	Mutation：D135N, Q223K	MG MAGNESIUM ION × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；277 K；0.1 M Bis(2-hydroxyethyl)amino-tris(hydroxymethyl)methane, 0.1 M Ammonium sulfate, 25% PEG 3350, 19mM Methyl 6-O-(N-heptylcarbamoyl)-alpha-D-glucopyranoside	Resolution 2.56 Å R-free 0.281
7UJQ Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B Deposited 2022-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 7–274（268 aa）	Mutation：D135N, Q223K	UZD methyl 6-O-(heptylcarbamoyl)-beta-L-altropyranoside × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；277 K；0.1 M Bis(2-hydroxyethyl)amino-tris(hydroxymethyl)methane, 0.1 M Ammonium sulfate, 25% PEG 3350, 19mM Methyl 6-O-(N-heptylcarbamoyl)-alpha-D-glucopyranoside	Resolution 2.25 Å R-free 0.271
7UJQ Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B Deposited 2022-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 7–274（268 aa）	Mutation：D135N, Q223K	UZD methyl 6-O-(heptylcarbamoyl)-beta-L-altropyranoside × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；277 K；0.1 M Bis(2-hydroxyethyl)amino-tris(hydroxymethyl)methane, 0.1 M Ammonium sulfate, 25% PEG 3350, 19mM Methyl 6-O-(N-heptylcarbamoyl)-alpha-D-glucopyranoside	Resolution 2.25 Å R-free 0.271
7UJR Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B Deposited 2022-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 7–274（268 aa）	Mutation：Q223K	EDO 1,2-ETHANEDIOL × 3 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；277 K；0.1M 1,3-bis(tris(hydroxymethyl)methylamino)propane, 0.1 M Ammonium sulfate, 20% PEG 3350, 5% Ethanol	Resolution 1.95 Å R-free 0.252
7UJS Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B in complex with ADP Deposited 2022-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 7–274（268 aa）	Mutation：Q223K	ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.6；277 K；0.1M 1,3-bis(tris(hydroxymethyl)methylamino)propane, 0.1 M Ammonium sulfate, 20% PEG 3350	Resolution 2.75 Å R-free 0.262
7UJT Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D) in complex with ATP Deposited 2022-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 7–274（268 aa）	Mutation：D135N, Q223K	ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GOL GLYCEROL × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；0.1M 1,3-bis(tris(hydroxymethyl)methylamino)propane, 0.2 M Sodium chloride, 25% PEG 3350	Resolution 2.10 Å R-free 0.246
9EOY Structure of Thr354Asn, Glu355Gln, Thr412Asn, Ile414Met, Ile464His, and Phe467Met mutant human CaMKII alpha hub bound to PIPA Deposited 2024-03-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 14 PDB declaration: tetradecameric	Chain A 345–475（131 aa） Chain B 345–475（131 aa） Chain C 345–475（131 aa） Chain D 345–475（131 aa） Chain E 345–475（131 aa） Chain F 345–475（131 aa） Chain G 345–475（131 aa）	Mutation：T354N, E355Q, T412N, I414M, I464H, and F467M Mutation：T354N, E355Q, T412N, I414M, I464H, and F467M Mutation：T354N, E355Q, T412N, I414M, I464H, and F467M Mutation：T354N, E355Q, T412N, I414M, I464H, and F467M Mutation：T354N, E355Q, T412N, I414M, I464H, and F467M Mutation：T354N, E355Q, T412N, I414M, I464H, and F467M Mutation：T354N, E355Q, T412N, I414M, I464H, and F467M	ACT ACETATE ION × 12 A1H6K 2-[6-(4-chlorophenyl)imidazo[1,2-b]pyridazin-2-yl]ethanoic acid × 4 PG4 TETRAETHYLENE GLYCOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293.15 K；500 nL protein + 2.65 mM compound in 25 mM Tris, 150 mM KCl, 10 mM imidazole, 1 mM DTT, 10% glycerol, pH 8.5, 10% DMSO + 1000 nL well solution (11% w/v PEG3350, 300 mM potassium acetate, pH 8.0), equilibrated against 50 uL well solution.	Resolution 2.10 Å R-free 0.251

21 other PDB entries and 28 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	KCC2A_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–135； UniProt 345–475 Author chain B； PDBConstruct 5–135； UniProt 345–475 Author chain C； PDBConstruct 5–135； UniProt 345–475 Author chain D； PDBConstruct 5–135； UniProt 345–475 Author chain E； PDBConstruct 5–135； UniProt 345–475 Author chain F； PDBConstruct 5–135； UniProt 345–475 Author chain G； PDBConstruct 5–135； UniProt 345–475

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7rec
Deposition date deposition_date	2021-07-12
Structure title title	Structure of Thr354Asn, Glu355Gln, Thr412Asn, Ile414Met, Ile464His, and Phe467Met mutant human CaMKII alpha hub bound to 5-HDC
Keywords keywords	CaMKII hub, oligomer, SIGNALING PROTEIN; SIGNALING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	35.61 Å
Radius of gyration Rg (electron density) rg_electron	35.25 Å
Forward intensity I(0) i0	186015000.00
Molecular weight molecular_weight	105460.0 kDa
Excluded volume excluded_volume	129990 Å³
Envelope volume envelope_volume	176970 Å³
Hydration-shell volume shell_volume	42611 Å³
Envelope diameter envelope_diameter	123.8 Å
Shell Rg shell_rg	41.12 Å
Envelope Rg envelope_rg	34.77 Å
Shape Rg shape_rg	35.21 Å
Total Rg total_rg	35.78 Å
Total atoms total_atoms	7404
Residues n_residues	899
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	119.3 Å
Rg (real space) rg_real	35.71 Å
Rg uncertainty (real space) rg_real_error	0.85 Å
I(0) (real space) i0_real	1.8600e+08
I(0) uncertainty (real space) i0_real_error	2.8550e+06
Rg (reciprocal space) rg_reciprocal	35.65 Å
I(0) (reciprocal space) i0_reciprocal	186000000.0000
Solution quality estimate total_estimate	0.8799
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	40.7 Å
Skewness Skewness skewness	0.362
Kurtosis Kurtosis kurtosis	-0.461
Angular range angular_range	— – 0.2200 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	22530000.0000
Real-space data points n_real_points	45
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.876; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.922; Smooth: 0.883

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Calcium/calmodulin-dependent protein kinase type II subunit alpha
Molecular weight formula_weight	15551.6 kDa
Mutation mutation	T354N, E355Q, T412N, I414M, I464H, F467M
Source method src_method	man
Copy count entity_count	7

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,D,A,B,C,E,F
Atom count atom_count	7511

GPHMVRKQEIIKVNQQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPVHNTMLNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQHVHMHRSGAPSV

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	5-hydroxydiclofenac
Molecular weight formula_weight	312.1 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 3 Entity 3 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	87

▼

7. Fold Classification (SCOP + CATH) 13 domains

SCOP 2.08 (13 domains)

Domain ID domain_id	d7reca1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.17 — Cystatin-like
Superfamily Superfamily superfamily	d.17.4 — NTF2-like
Family Family family	d.17.4.7 — Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A

Domain ID domain_id	d7reca2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d7recb_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.17 — Cystatin-like
Superfamily Superfamily superfamily	d.17.4 — NTF2-like
Family Family family	d.17.4.7 — Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A

Domain ID domain_id	d7recc1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.17 — Cystatin-like
Superfamily Superfamily superfamily	d.17.4 — NTF2-like
Family Family family	d.17.4.7 — Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A

Domain ID domain_id	d7recc2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d7recd1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.17 — Cystatin-like
Superfamily Superfamily superfamily	d.17.4 — NTF2-like
Family Family family	d.17.4.7 — Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A

Domain ID domain_id	d7recd2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d7rece1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.17 — Cystatin-like
Superfamily Superfamily superfamily	d.17.4 — NTF2-like
Family Family family	d.17.4.7 — Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A

Domain ID domain_id	d7rece2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d7recf1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.17 — Cystatin-like
Superfamily Superfamily superfamily	d.17.4 — NTF2-like
Family Family family	d.17.4.7 — Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A

Domain ID domain_id	d7recf2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d7recg1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.17 — Cystatin-like
Superfamily Superfamily superfamily	d.17.4 — NTF2-like
Family Family family	d.17.4.7 — Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A

Domain ID domain_id	d7recg2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

▶

8. Citations (1)

▶

Unit-cell length a length_a	101.433 Å
Unit-cell length b length_b	182.958 Å
Unit-cell length c length_c	106.466 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	56

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	—

Resolution resolution	2.200 Å
Low-resolution limit resolution_low	91.479 Å
R factor r_factor	0.2100
R_work r_work	0.2088
R_free r_free	0.2437

fit	/app/data/saxs_computation/re/7rec/7rec.fit
pddf	/app/data/pr_computation/re/7rec/7rec.pr.out
profile	/app/data/saxs_computation/re/7rec/7rec.dat

Structure of Thr354Asn, Glu355Gln, Thr412Asn, Ile414Met, Ile464His, and Phe467Met mutant human CaMKII alpha hub bound to 5-HDC

1. Protein Identity and Related Structures Protein Identity & Related Structures

Calcium/calmodulin-dependent protein kinase type II subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction