SAXSdb — 7smc

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Retinoblastoma-like protein 1

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 391–601 Chain A； UniProt 780–887 Chain A； UniProt 924–972	Fragment：UNP residues 391-601,780-887,924-972	AT-rich interactive domain-containing protein 4A × 1 （P29374） SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；277 K；100 mM MES, pH 6.5, 4% PEG400, 1.6 M ammonium sulfate	Resolution 2.70 Å R-free 0.298
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain C； UniProt 391–601 Chain C； UniProt 780–887 Chain C； UniProt 924–972	Fragment：UNP residues 391-601,780-887,924-972	AT-rich interactive domain-containing protein 4A × 1 （P29374）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；277 K；100 mM MES, pH 6.5, 4% PEG400, 1.6 M ammonium sulfate	Resolution 2.70 Å R-free 0.298

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7SMC	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1H28 CDK2/CyclinA in complex with an 11-residue recruitment peptide from p107 Deposited 2002-07-31	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 653–663（11 aa） Fragment：RB PEPTIDE, RESIDUES 653-663	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；0.8M KCL, 1.2M (NH4)2SO4, 40MM HEPES PH 7.0. PROTEIN CONCENTRATION = 10MG/ML	Resolution 2.80 Å R-free 0.323
1H28 CDK2/CyclinA in complex with an 11-residue recruitment peptide from p107 Deposited 2002-07-31	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 653–663（11 aa） Fragment：RB PEPTIDE, RESIDUES 653-663	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；0.8M KCL, 1.2M (NH4)2SO4, 40MM HEPES PH 7.0. PROTEIN CONCENTRATION = 10MG/ML	Resolution 2.80 Å R-free 0.323
4YOO p107 pocket domain in complex with LIN52 P29A peptide Deposited 2015-03-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 391–600（210 aa） Fragment：unp residues 391-600,unp residues 781-972 Chain A 781–972（192 aa） Fragment：unp residues 391-600,unp residues 781-972	Not recorded	SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；277 K；MES, PEG 400 4%, 1.6M ammonium sulfate	Resolution 2.40 Å R-free 0.242
4YOS p107 pocket domain complexed with LIN52 peptide Deposited 2015-03-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 391–600（210 aa） Fragment：unp residues 391-600,unp residues 781-969,unp residues 391-600,unp residues 781-969	Not recorded	SO4 SULFATE ION × 2 EDO 1,2-ETHANEDIOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；277 K；MES, PEG 400 4%, 1.6M ammonium sulfate	Resolution 2.30 Å R-free 0.242
4YOZ p107 pocket domain in complex with HPV E7 peptide Deposited 2015-03-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 391–593（203 aa） Fragment：unp residues 391-593,unp residues 391-593 Chain A 777–972（196 aa） Fragment：unp residues 391-593,unp residues 391-593	Not recorded	SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；Hepes, Ammonium Sulfate, PEG 400	Resolution 2.25 Å R-free 0.240
5TUV Crystal structure of the E2F5-DP1-p107 ternary complex Deposited 2016-11-07	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 994–1031（38 aa） Fragment：UNP residues 994-1031	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；100mM Hepes pH 7.0, 7% PEG 5000, 5% 1-propanol, 2% 2-propanol	Resolution 2.90 Å R-free 0.260
5TUV Crystal structure of the E2F5-DP1-p107 ternary complex Deposited 2016-11-07	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 994–1031（38 aa） Fragment：UNP residues 994-1031	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；100mM Hepes pH 7.0, 7% PEG 5000, 5% 1-propanol, 2% 2-propanol	Resolution 2.90 Å R-free 0.260
5TUV Crystal structure of the E2F5-DP1-p107 ternary complex Deposited 2016-11-07	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 994–1031（38 aa） Fragment：UNP residues 994-1031 Chain F 994–1031（38 aa） Fragment：UNP residues 994-1031	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；100mM Hepes pH 7.0, 7% PEG 5000, 5% 1-propanol, 2% 2-propanol	Resolution 2.90 Å R-free 0.260
7SMD p107 pocket domain complexed with EID1 peptide Deposited 2021-10-25	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 391–601（211 aa） Fragment：UNP residues 391-601,780-887,924-972 Chain A 780–887（108 aa） Fragment：UNP residues 391-601,780-887,924-972 Chain A 924–972（49 aa） Fragment：UNP residues 391-601,780-887,924-972	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；100 mM MES, pH 6.5, 4% PEG400, 1.6 M ammonium sulfate	Resolution 2.15 Å R-free 0.259
7SME p107 pocket domain complexed with HDAC1 peptide Deposited 2021-10-25	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 391–601（211 aa） Fragment：UNP residues 391-601,780-887,924-972 Chain A 780–887（108 aa） Fragment：UNP residues 391-601,780-887,924-972 Chain A 924–972（49 aa） Fragment：UNP residues 391-601,780-887,924-972	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；100 mM MES, pH 6.5, 4% PEG400, 1.6 M ammonium sulfate	Resolution 2.64 Å R-free 0.277
7SMF p107 pocket domain complexed with mutated HDAC1-3X peptide Deposited 2021-10-25	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 391–601（211 aa） Fragment：UNP residues 391-601,780-887,924-972 Chain A 780–887（108 aa） Fragment：UNP residues 391-601,780-887,924-972 Chain A 924–972（49 aa） Fragment：UNP residues 391-601,780-887,924-972	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；100 mM MES, pH 6.5, 4% PEG400, 1.6 M ammonium sulfate	Resolution 3.00 Å R-free 0.301
7SMF p107 pocket domain complexed with mutated HDAC1-3X peptide Deposited 2021-10-25	Different ligand/ion Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 391–601（211 aa） Fragment：UNP residues 391-601,780-887,924-972 Chain C 780–887（108 aa） Fragment：UNP residues 391-601,780-887,924-972 Chain C 924–972（49 aa） Fragment：UNP residues 391-601,780-887,924-972	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；100 mM MES, pH 6.5, 4% PEG400, 1.6 M ammonium sulfate	Resolution 3.00 Å R-free 0.301
9C6B PP2A:B55-p107 substrate complex Deposited 2024-06-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 612–687（76 aa） Fragment：residues 612-687	Not recorded	FE2 FE (II) ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å

9 other PDB entries and 13 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RBL1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–214； UniProt 391–601 Author chain A； PDBConstruct 215–322； UniProt 780–887 Author chain A； PDBConstruct 323–371； UniProt 924–972 Author chain C； PDBConstruct 4–214； UniProt 391–601 Author chain C； PDBConstruct 215–322； UniProt 780–887 Author chain C； PDBConstruct 323–371； UniProt 924–972

AT-rich interactive domain-containing protein 4A

OrganismNot specified

UniProt P29374

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 953–967	Fragment：UNP residues 953-967	Retinoblastoma-like protein 1 × 1 （P28749） SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；277 K；100 mM MES, pH 6.5, 4% PEG400, 1.6 M ammonium sulfate	Resolution 2.70 Å R-free 0.298
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain D； UniProt 953–967	Fragment：UNP residues 953-967	Retinoblastoma-like protein 1 × 1 （P28749）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；277 K；100 mM MES, pH 6.5, 4% PEG400, 1.6 M ammonium sulfate	Resolution 2.70 Å R-free 0.298

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7SMC	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2LCC Solution structure of RBBP1 chromobarrel domain Deposited 2011-04-28	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 568–635（68 aa） Fragment：UNP RESIDUES 568-635	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 0.4；Pressure ambient NMR sample composition 0.5 mM [U-95% 15N] entity-1, 50 mM sodium phosphate-2, 50 mM sodium chloride-3, 5 mM DTT-4, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.5 mM [U-95% 13C; U-95% 15N] entity-5, 50 mM sodium phosphate-6, 50 mM sodium chloride-7, 5 mM DTT-8, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2MAM Solution structure of the interdigitated double Tudor domain of RBBP1 Deposited 2013-07-15	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 4–121（118 aa） Fragment：UNP RESIDUES 4-121	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.8；298 K；Ionic strength (raw mmCIF value) 100；Pressure ambient NMR sample composition 0.6 mM [U-95% 13C; U-95% 15N] entity-1, 10 % [U-99% 2H] D2O-2, 0.0004 % DSS-3, 15 mM DTT-4, 50 mM sodium chloride-5, 50 mM TRIS-6, 2 mM EDTA-7, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2YRV Solution structure of the RBB1NT domain of human RB(retinoblastoma)-binding protein 1 Deposited 2007-04-03	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 170–273（104 aa） Fragment：UNP region 170-273	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 120mM；Pressure ambient NMR sample composition 1.2mM sample U-15N,13C; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O \| 90% H2O/10% D2O	Resolution not provided
6BPH Crystal structure of the chromodomain of RBBP1 Deposited 2017-11-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 568–635（68 aa）	Not recorded	UNX UNKNOWN LIGAND × 34	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；25% PEG 3350, 0.2M magnesium chloride, 0.1M HEPES, pH 7.5	Resolution 1.85 Å R-free 0.226
6L87 Solution structure of the tandem PWWP-ARID domains of human RBBP1 Deposited 2019-11-05	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 171–414（244 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6；302 K；Ionic strength (raw mmCIF value) 720；Pressure 1 NMR sample composition 10 mM sodium phosphate, 700 mM sodium chloride, 1 mM EDTA, 1 mM DTT, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 10 mM sodium phosphate, 700 mM sodium chloride, 1 mM EDTA, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
7V8N Crystal structure of the PWWP-ARID domain of ARID4A Deposited 2021-08-23	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 169–417（249 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；2.4 M ammonium phosphate dibasic, 0.1 M Tris pH8.0	Resolution 2.05 Å R-free 0.231
7V8N Crystal structure of the PWWP-ARID domain of ARID4A Deposited 2021-08-23	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 169–417（249 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；2.4 M ammonium phosphate dibasic, 0.1 M Tris pH8.0	Resolution 2.05 Å R-free 0.231

6 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ARI4A_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–15； UniProt 953–967 Author chain D； PDBConstruct 1–15； UniProt 953–967

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7smc
Deposition date deposition_date	2021-10-25
Structure title title	p107 pocket domain complexed with ARID4A peptide
Keywords keywords	Transcription, cyclin box pocket transcriptional regulator, cell cycle; CELL CYCLE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	29.43 Å
Radius of gyration Rg (electron density) rg_electron	28.24 Å
Forward intensity I(0) i0	103221000.00
Molecular weight molecular_weight	81345.0 kDa
Excluded volume excluded_volume	102440 Å³
Envelope volume envelope_volume	128700 Å³
Hydration-shell volume shell_volume	37374 Å³
Envelope diameter envelope_diameter	93.4 Å
Shell Rg shell_rg	35.99 Å
Envelope Rg envelope_rg	28.03 Å
Shape Rg shape_rg	28.21 Å
Total Rg total_rg	29.12 Å
Total atoms total_atoms	5719
Residues n_residues	705
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	89.0 Å
Rg (real space) rg_real	29.27 Å
Rg uncertainty (real space) rg_real_error	0.59 Å
I(0) (real space) i0_real	1.0320e+08
I(0) uncertainty (real space) i0_real_error	1.4140e+06
Rg (reciprocal space) rg_reciprocal	29.34 Å
I(0) (reciprocal space) i0_reciprocal	103200000.0000
Solution quality estimate total_estimate	0.9080
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	41.2 Å
Skewness Skewness skewness	0.106
Kurtosis Kurtosis kurtosis	-0.522
Angular range angular_range	— – 0.2700 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	24650000.0000
Real-space data points n_real_points	55
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.952; Stabil: 0.999; Sysdev: 1.000; Positv: 1.000; Valcen: 0.987; Smooth: 0.961

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Retinoblastoma-like protein 1
Molecular weight formula_weight	43266.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	5749

GEFTQSVSRLQSIVAGLKNAPSDQLINIFESCVRNPVENIMKILKGIGETFCQHYTQSTDEQPGSHIDFAVNRLKLAEILYYKILETVMVQETRRLHGMDMSVLLEQDIFHRSLMACCLEIVLFAYSSPRTFPWIIEVLNLQPFYFYKVIEVVIRSEEGLSRDMVKHLNSIEEQILESLAWSHDSALWEALQVSANKVPTCEEVIFPNNFETGNNRPKRTGSLALFYRKVYHLASVRLRDLCLKLDVSNELRRKIWTCFEFTLVHCPDLMKDRHLDQLLLCAFYIMAKVTKEERTFQEIMKSYRNQPQANSHVYRSVLLKSIKEERGDLIKFYNTIYVGRVKSFALKYDLANQDHMMDAPPLSPFPHIKQQ

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	AT-rich interactive domain-containing protein 4A
Molecular weight formula_weight	1655.8 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

GPETLVCHEVDLDDL

Entity 3 Entity 3 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	30

▶

8. Citations (1)

▶

Unit-cell length a length_a	62.863 Å
Unit-cell length b length_b	62.923 Å
Unit-cell length c length_c	71.274 Å
Unit-cell angle α angle_alpha	69.89 °
Unit-cell angle β angle_beta	76.00 °
Unit-cell angle γ angle_gamma	74.36 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.700 Å
Low-resolution limit resolution_low	47.110 Å
R factor r_factor	0.2407
R_work r_work	0.2380
R_free r_free	0.2982

fit	/app/data/saxs_computation/sm/7smc/7smc.fit
pddf	/app/data/pr_computation/sm/7smc/7smc.pr.out
profile	/app/data/saxs_computation/sm/7smc/7smc.dat

p107 pocket domain complexed with ARID4A peptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

Retinoblastoma-like protein 1

State in the Current Structure

Other States of the Same Protein in the Database

AT-rich interactive domain-containing protein 4A

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)