SAXSdb — 7szo

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chaperone protein FimC

Escherichia coli

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 5	FimF protein × 2 （A0A1M0WRP3） FimG × 1 （A8HPB0） FimH,F1C putative fimbrial adhesin fusion × 1 （A8KI79,Q9F6Z7） water × 3	Consistent with protein count
2	Insufficient information	Heteromer	Protein 5	FimF protein × 2 （A0A1M0WRP3） FimG × 1 （A8HPB0） FimH,F1C putative fimbrial adhesin fusion × 1 （A8KI79,Q9F6Z7） GLYCEROL × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FIMC_ECOLI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain C； PDBConstruct 1–205； UniProt 37–241 Author chain I； PDBConstruct 1–205； UniProt 37–241

FimF protein

Escherichia coli

UniProt A0A1M0WRP3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 5	Chaperone protein FimC × 1 （P31697） FimG × 1 （A8HPB0） FimH,F1C putative fimbrial adhesin fusion × 1 （A8KI79,Q9F6Z7） water × 3	Consistent with protein count
2	Insufficient information	Heteromer	Protein 5	Chaperone protein FimC × 1 （P31697） FimG × 1 （A8HPB0） FimH,F1C putative fimbrial adhesin fusion × 1 （A8KI79,Q9F6Z7） GLYCEROL × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A1M0WRP3_ECOLX
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 1–154； UniProt 23–176 Author chain F； PDBConstruct 1–154； UniProt 23–176 Author chain K； PDBConstruct 1–154； UniProt 23–176 Author chain L； PDBConstruct 1–154； UniProt 23–176

FimG

Escherichia coli

UniProt A8HPB0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 5	Chaperone protein FimC × 1 （P31697） FimF protein × 2 （A0A1M0WRP3） FimH,F1C putative fimbrial adhesin fusion × 1 （A8KI79,Q9F6Z7） water × 3	Consistent with protein count
2	Insufficient information	Heteromer	Protein 5	Chaperone protein FimC × 1 （P31697） FimF protein × 2 （A0A1M0WRP3） FimH,F1C putative fimbrial adhesin fusion × 1 （A8KI79,Q9F6Z7） GLYCEROL × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8HPB0_ECOLX
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain G； PDBConstruct 1–144； UniProt 26–169 Author chain M； PDBConstruct 1–144； UniProt 26–169

FimH,F1C putative fimbrial adhesin fusion

Escherichia coli

UniProt A8KI79

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 5	Chaperone protein FimC × 1 （P31697） FimF protein × 2 （A0A1M0WRP3） FimG × 1 （A8HPB0） water × 3	Consistent with protein count
2	Insufficient information	Heteromer	Protein 5	Chaperone protein FimC × 1 （P31697） FimF protein × 2 （A0A1M0WRP3） FimG × 1 （A8HPB0） GLYCEROL × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8KI79_ECOLX
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain H； PDBConstruct 186–201； UniProt 243–258 Author chain N； PDBConstruct 186–201； UniProt 243–258

FimH,F1C putative fimbrial adhesin fusion

Escherichia coli

UniProt Q9F6Z7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 5	Chaperone protein FimC × 1 （P31697） FimF protein × 2 （A0A1M0WRP3） FimG × 1 （A8HPB0） water × 3	Consistent with protein count
2	Insufficient information	Heteromer	Protein 5	Chaperone protein FimC × 1 （P31697） FimF protein × 2 （A0A1M0WRP3） FimG × 1 （A8HPB0） GLYCEROL × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9F6Z7_ECOLX
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain H； PDBConstruct 1–185； UniProt 22–206 Author chain H； PDBConstruct 202–279； UniProt 223–300 Author chain N； PDBConstruct 1–185； UniProt 22–206 Author chain N； PDBConstruct 202–279； UniProt 223–300

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7szo
Deposition date deposition_date	2021-11-29
Structure title title	Structure of a bacterial fimbrial tip containing FocH
Keywords keywords	FIMBRIA, CELL ADHESION, FOCH; CELL ADHESION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7szo__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7szo__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7szo__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	66.18 Å
Rg (electron density)	69.17 Å
Total Rg	68.44 Å
Atom count	6902
Residues	929
Excluded volume	122410 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7szo__assembly_1__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`7szo__assembly_2__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Chaperone protein FimC
Molecular weight formula_weight	22754.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,I
Atom count atom_count	13894

GVALGATRVIYPAGQKQEQLAVTNNDENSTYLIQSWVENADGVKDGRFIVTPPLFAMKGKKENTLRILDATNNQLPQDRESLFWMNVKAIPSMDKSKLTENTLQLAIISRIKLYYRPAKLALPPDQAAEKLRFRRSANSLTLINPTPYYLTVTELNAGTRVLENALVPPMGESTVKLPSDAGSNITYRTINDYGALTPKMTGVME

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	FimF protein
Molecular weight formula_weight	16161.1 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,K,L

ADSTITIRGYVRDNGCSVAAESTNFTVDLMENAAKQFNNIGATTPVVPFRILLSPCGNAVSAVKVGFTGVADSHNANLLALENTVSAAAGLGIQLLNEQQNQIPLNAPSSALSWTTLTPGKPNTLNFYARLMATQVPVTAGHINATATFTLEYQ

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	FimG
Molecular weight formula_weight	14864.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,M

ADVTITVNGKVVAKPCTVSTTNATVDLGDLYSFSLMSAGAASAWHDVALELTNCPVGTSRVTASFSGAADSTGYYKNQGTAQNIQLELQDDSGNTLNTGATKTVQVDDSSQSAHFPLQVRALTVNGGATQGTIQAVISITYTYS

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	FimH,F1C putative fimbrial adhesin fusion
Molecular weight formula_weight	29015.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,N

FACKTANGTAIPIGGGSANVYVNLAPAVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSSFSGTVKYNGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVRCDQTQSVSYTLSGSVADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	35

▶

Unit-cell length a length_a	214.777 Å
Unit-cell length b length_b	214.777 Å
Unit-cell length c length_c	532.051 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	72

Space group space_group	H 3 2
Space-group number int_tables_number	155
Crystal system crystal_system	—

Resolution resolution	2.800 Å
Low-resolution limit resolution_low	176.780 Å
R factor r_factor	0.2464
R_work r_work	0.2449
R_free r_free	0.2735

Structure of a bacterial fimbrial tip containing FocH

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chaperone protein FimC

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

FimF protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

FimG

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

FimH,F1C putative fimbrial adhesin fusion

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

FimH,F1C putative fimbrial adhesin fusion

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7szo__assembly_1__model_1

7szo__assembly_1__model_1 | I(q)

7szo__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)