7u8q

Structure of porcine kidney V-ATPase with SidK, Rotary State 2

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

V-type proton ATPase catalytic subunit A

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit F × 1 （F1SMN6） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1UJS8） V-type proton ATPase subunit × 1 （A0A4X1U843） Ribonuclease kappa × 1 （A0A480L8C4） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VATA_PIG
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–617； UniProt 1–617 Author chain B； PDBConstruct 1–617； UniProt 1–617 Author chain C； PDBConstruct 1–617； UniProt 1–617

Vacuolar proton pump subunit B

OrganismNot specified

UniProt A0A4X1W9K3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	V-type proton ATPase catalytic subunit A × 3 （Q29048） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit F × 1 （F1SMN6） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1UJS8） V-type proton ATPase subunit × 1 （A0A4X1U843） Ribonuclease kappa × 1 （A0A480L8C4） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1W9K3_PIG
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–515； UniProt 1–515 Author chain E； PDBConstruct 1–515； UniProt 1–515 Author chain F； PDBConstruct 1–515； UniProt 1–515

V-type proton ATPase subunit C

OrganismNot specified

UniProt F1S0R4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	V-type proton ATPase catalytic subunit A × 3 （Q29048） Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit F × 1 （F1SMN6） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1UJS8） V-type proton ATPase subunit × 1 （A0A4X1U843） Ribonuclease kappa × 1 （A0A480L8C4） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1S0R4_PIG
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain G； PDBConstruct 1–382； UniProt 1–382

V-type proton ATPase subunit D

OrganismNot specified

UniProt A0A286ZJL5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	V-type proton ATPase catalytic subunit A × 3 （Q29048） Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit F × 1 （F1SMN6） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1UJS8） V-type proton ATPase subunit × 1 （A0A4X1U843） Ribonuclease kappa × 1 （A0A480L8C4） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A286ZJL5_PIG
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain H； PDBConstruct 1–247； UniProt 1–247

V-type proton ATPase subunit E 1

OrganismNot specified

UniProt K9J4U3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	V-type proton ATPase catalytic subunit A × 3 （Q29048） Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit F × 1 （F1SMN6） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1UJS8） V-type proton ATPase subunit × 1 （A0A4X1U843） Ribonuclease kappa × 1 （A0A480L8C4） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	K9J4U3_PIG
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain I； PDBConstruct 1–226； UniProt 1–226 Author chain J； PDBConstruct 1–226； UniProt 1–226 Author chain K； PDBConstruct 1–226； UniProt 1–226

V-type proton ATPase subunit F

OrganismNot specified

UniProt F1SMN6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	V-type proton ATPase catalytic subunit A × 3 （Q29048） Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1UJS8） V-type proton ATPase subunit × 1 （A0A4X1U843） Ribonuclease kappa × 1 （A0A480L8C4） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SMN6_PIG
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain L； PDBConstruct 1–119； UniProt 1–119

V-type proton ATPase subunit G

OrganismNot specified

UniProt A0A4X1UZN2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	V-type proton ATPase catalytic subunit A × 3 （Q29048） Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit F × 1 （F1SMN6） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1UJS8） V-type proton ATPase subunit × 1 （A0A4X1U843） Ribonuclease kappa × 1 （A0A480L8C4） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1UZN2_PIG
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain M； PDBConstruct 1–118； UniProt 1–118 Author chain N； PDBConstruct 1–118； UniProt 1–118 Author chain O； PDBConstruct 1–118； UniProt 1–118

Bacterial effector protein SidK

Legionella pneumophila

UniProt Q5ZWW6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	V-type proton ATPase catalytic subunit A × 3 （Q29048） Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit F × 1 （F1SMN6） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1UJS8） V-type proton ATPase subunit × 1 （A0A4X1U843） Ribonuclease kappa × 1 （A0A480L8C4） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q5ZWW6_LEGPH
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain Q； PDBConstruct 1–337； UniProt 1–337 Author chain R； PDBConstruct 1–337； UniProt 1–337 Author chain S； PDBConstruct 1–337； UniProt 1–337

V-type proton ATPase subunit H

OrganismNot specified

UniProt Q9TVC1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	V-type proton ATPase catalytic subunit A × 3 （Q29048） Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit F × 1 （F1SMN6） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1UJS8） V-type proton ATPase subunit × 1 （A0A4X1U843） Ribonuclease kappa × 1 （A0A480L8C4） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VATH_PIG
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain T； PDBConstruct 1–483； UniProt 1–483

V-type proton ATPase subunit a

OrganismNot specified

UniProt A0A4X1U3K4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	V-type proton ATPase catalytic subunit A × 3 （Q29048） Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit F × 1 （F1SMN6） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1UJS8） V-type proton ATPase subunit × 1 （A0A4X1U843） Ribonuclease kappa × 1 （A0A480L8C4） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1U3K4_PIG
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain a； PDBConstruct 1–838； UniProt 1–838

V-type proton ATPase 21 kDa proteolipid subunit isoform 1

OrganismNot specified

UniProt A0A480L444

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	V-type proton ATPase catalytic subunit A × 3 （Q29048） Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit F × 1 （F1SMN6） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1UJS8） V-type proton ATPase subunit × 1 （A0A4X1U843） Ribonuclease kappa × 1 （A0A480L8C4） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A480L444_PIG
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain b； PDBConstruct 1–205； UniProt 1–205

ATPase H+ transporting accessory protein 1

OrganismNot specified

UniProt K9IWA3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	V-type proton ATPase catalytic subunit A × 3 （Q29048） Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit F × 1 （F1SMN6） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） V-type proton ATPase subunit × 1 （A0A4X1UJS8） V-type proton ATPase subunit × 1 （A0A4X1U843） Ribonuclease kappa × 1 （A0A480L8C4） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	K9IWA3_PIG
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain c； PDBConstruct 1–469； UniProt 1–469

V-type proton ATPase subunit

OrganismNot specified

UniProt A0A4X1UJS8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	V-type proton ATPase catalytic subunit A × 3 （Q29048） Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit F × 1 （F1SMN6） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1U843） Ribonuclease kappa × 1 （A0A480L8C4） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1UJS8_PIG
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain d； PDBConstruct 1–351； UniProt 1–351

V-type proton ATPase subunit

OrganismNot specified

UniProt A0A4X1U843

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	V-type proton ATPase catalytic subunit A × 3 （Q29048） Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit F × 1 （F1SMN6） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1UJS8） Ribonuclease kappa × 1 （A0A480L8C4） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1U843_PIG
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain e； PDBConstruct 1–81； UniProt 1–81

Ribonuclease kappa

OrganismNot specified

UniProt A0A480L8C4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	V-type proton ATPase catalytic subunit A × 3 （Q29048） Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit F × 1 （F1SMN6） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1UJS8） V-type proton ATPase subunit × 1 （A0A4X1U843） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A480L8C4_PIG
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain f； PDBConstruct 1–98； UniProt 118–215

V-type proton ATPase proteolipid subunit

OrganismNot specified

UniProt A0A4X1VUN6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	V-type proton ATPase catalytic subunit A × 3 （Q29048） Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit F × 1 （F1SMN6） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1UJS8） V-type proton ATPase subunit × 1 （A0A4X1U843） Ribonuclease kappa × 1 （A0A480L8C4） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1VUN6_PIG
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain g； PDBConstruct 1–155； UniProt 1–155 Author chain h； PDBConstruct 1–155； UniProt 1–155 Author chain i； PDBConstruct 1–155； UniProt 1–155 Author chain j； PDBConstruct 1–155； UniProt 1–155 Author chain k； PDBConstruct 1–155； UniProt 1–155 Author chain l； PDBConstruct 1–155； UniProt 1–155 Author chain m； PDBConstruct 1–155； UniProt 1–155 Author chain n； PDBConstruct 1–155； UniProt 1–155 Author chain o； PDBConstruct 1–155； UniProt 1–155

ATPase H(+)-transporting lysosomal accessory protein 2

OrganismNot specified

UniProt A0A287AJK1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	V-type proton ATPase catalytic subunit A × 3 （Q29048） Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit F × 1 （F1SMN6） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1UJS8） V-type proton ATPase subunit × 1 （A0A4X1U843） Ribonuclease kappa × 1 （A0A480L8C4） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287AJK1_PIG
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain p； PDBConstruct 1–351； UniProt 1–351

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7u8q
Deposition date deposition_date	2022-03-09
Structure title title	Structure of porcine kidney V-ATPase with SidK, Rotary State 2
Keywords keywords	proton translocation, complex, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7u8q__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7u8q__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7u8q__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	79.53 Å
Rg (electron density)	78.10 Å
Total Rg	77.42 Å
Atom count	62638
Residues	8978
Excluded volume	1094100 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7u8q__assembly_1__model_1`	35-meric （35）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (18)

Entity 1 Entity 1 polymer

Description description	V-type proton ATPase catalytic subunit A
Molecular weight formula_weight	68393.8 kDa
EC 编号 ec_number	7.1.2.2
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	62638

MDFSKLPKILDEDKESTFGYVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPRGVNVSALSRDVKWEFTPSKNLRVGSHITGGDIYGIVNENSLIKHRIMLPPRNRGTVTYIAPPGNYDTSDVVLELEFEGVKEKFSMVQVWPVRQVRPVTEKLPANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERVNEMSEVLRDFPELTMEVDGKVESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYHVSMMANSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNPEREGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSVNWLISYSKYMRALDEYYDKHFTEFVPLRTKAKEILQEEEDLAEIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMIAFYDLARRAVETTAQSDNKITWSIIREHMGEILYKLSSMKFKDPVKDGEAKIKADYAQLLEDVQNAFRSLED

Entity 2 Entity 2 polymer

Description description	Vacuolar proton pump subunit B
Molecular weight formula_weight	57162.9 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F

MAMKVDSRPGGLPSSGSHLGTAREHVQAVTRNYITHPRVTYRTVCSVNGPLVVLDHVKFAQYAEIVNFTLPNGTQRSGQVLEVSGTKAIVQVFEGTSGIDAQKTTCEFTGDILRTPVSEDMLGRVFNGSGKPIDNGPVVMAEDFLDINGQPINPHDRIYPEEMIQTGISPIDVMNSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKKSKAVLDYDDDNFAIVFAAMGVNMETARFFKSDFEENGTMGNVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRGGSITQIPILTMPNDDITHPIPDLTGFITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHGDVSNQLYACYAIGKDVQAMKAVVGEEALTSEDLLYLEFLQKFERNFINQGPYEKRSVFESLDLGWKLLRIFPKEMLKRIPQSMIDEFYSREGAPQDPEPEPDTAL

Entity 3 Entity 3 polymer

Description description	V-type proton ATPase subunit C
Molecular weight formula_weight	44066.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MTEFWLISAPGEKTCQQTWEKLHAATTKNNNLALTSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLYELYKHLDSSAAAIIDAPVDIPGLNLSQQEYYPYVYYKIDCNLLEFK

Entity 4 Entity 4 polymer

Description description	V-type proton ATPase subunit D
Molecular weight formula_weight	28301.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRLKKIQEKKKILKEKSEKDLEQRRAAGEAMEPANLLAEEKDEDLLFE

Entity 5 Entity 5 polymer

Description description	V-type proton ATPase subunit E 1
Molecular weight formula_weight	26162.4 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J,K

MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLGKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPVYKIATKRDVDVQIDQEAYLPEEIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD

Entity 6 Entity 6 polymer

Description description	V-type proton ATPase subunit F
Molecular weight formula_weight	13403.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNREDIGIILINQYIAEMVRHALDAHQRSIPAVLEIPSKEHPYDAAKDSILRRAKGMFTAEDLR

Entity 7 Entity 7 polymer

Description description	V-type proton ATPase subunit G
Molecular weight formula_weight	13748.5 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,N,O

MASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKAKEAAALGSHGSCSTEVEKDTQEKMTILQTYFRQNRDEVLDNLLAFVCDIRPEIHENYRING

Entity 8 Entity 8 polymer

Description description	Bacterial effector protein SidK
Molecular weight formula_weight	38539.4 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q,R,S

MSFIKVGIKMGGLTSEQYHSQVVGKIGYIARCMQTIDPENNLKKIREDYQDVLIWAEKNYRFEEILEASKSGKCPNDLDALSRRSLILQELLRLVSSISPFKMKLDLIESQYEKMKQHVNLWKSDYHVKLNQLNQLTDYLKNAAPTPKNNFLRAMTSVLQMQIAQYGITEDNEGINQLFKLGLHLLAMANEKIDEQYHLFKGYVKDQPEESPFEGILPAEDQKILVKTMIDYAMPKLSSKVLQDKLSALSSSDVLTKTLLDSIDRIVKENEKLNALSKVKLGKFGLDIREIEVIYSQALKISPQDALQYTAQQCDAQLLSMAFPDSQNYIIESISNK

Source Source

Source organism organism	Legionella pneumophila
NCBI taxonomy ID ncbi_taxonomy_id	446
Host organism host_organism	Escherichia coli

Entity 9 Entity 9 polymer

Description description	V-type proton ATPase subunit H
Molecular weight formula_weight	55917.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MTKMDIRGAVDAAVPTNIIAAKAAEVRANKVNWQSYLQGQMISSEDCEFIQRFEMKRSPEEKQEMLQTEGSQCAKTFINLMTHISKEQTVQYILTMVDDTLQENHQRVSIFFDYAKRSKNTAWSYFLPMLNRQDLFTVHMAARIIAKLAAWGKELMEGSDLNYYFNWIKTQLASQKLRGSGVAVETGTVSSSDSSQYVQCVAGCLQLMLRVNEYRFAWVEADGVNCIMGVLSNKCGFQLQYQMIFSIWLLAFSPQMCEHLRRYNIIPVLSDILQESVKEKVTRIILAAFRNFLEKSTERETRQEYALALIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQSEQPQTAAARS

Entity 10 Entity 10 polymer

Description description	V-type proton ATPase subunit a
Molecular weight formula_weight	96365.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELKFILRKTQQFFDEMADPDLLEESSSLLEPNEMGRGTPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVTDLDSIQFALRRGTEHSGSTVPSILNRMQTNQTPPTYNKTNKFTCGFQNIVDAYGIGTYREINPAPYTIITFPFLFAVMFGDFGHGILMTLFAVWMVLRESRILSQKNENEMFSTVFSGRYIILLMGIFSIYTGLIYNDCFSKSLNIFGSSWSVRPMFDGYNWTEETLRGNPVLQLNPAVLGVFGGPYPFGIDPIWNIATNKLTFLNSFKMKMSVILGIIHMMFGVSLSLFNHIYFKRPLNIYFGFIPEIIFMTSLFGYLVILIFYKWTAYDAQTSEKAPSLLIHFINMFLFSYGDSGNSMLYSGQKGIQCFLVVVALLCVPWMLLIKPLVLRHQYLRRKHLGTLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVIHIGLSVKSLAGGLALFFIFAAFATLTVAILLIMEGLSAFLHALRLHWVEFQNKFYSGTGFKFLPFSFEHIREGKFDE

Entity 11 Entity 11 polymer

Description description	V-type proton ATPase 21 kDa proteolipid subunit isoform 1
Molecular weight formula_weight	21530.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MTGLVLLYSGVFVAFWACLLVVGICYTIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVAILQTSRVKMGD

Entity 12 Entity 12 polymer

Description description	ATPase H+ transporting accessory protein 1
Molecular weight formula_weight	51547.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MMAAAAAARVRAGTRRGPALWQMPWLPLVAVAVVAAASAAEQQVPLVLWSSDRNLWAPAANTHEGHITSDRQLSTYLDPALELGPRNVLLFLQDKLSVEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAVSTLTTYLQEKLGASPLHVDLATLRELKLNASLPALLLIRLPYTASSGLMAPKEVLTANDEVIGQVLSTLKSEEVPYTAALTAVRPSRVARDVAMVAGGLGRQLLQRPSASAATHPPVSYNDTAPRILFWAQNFSVAYGGRWEDLTSLTFGVQDLNLTGSFWNDSVAWLALTYDQLFGTMVTFKFILANRFYQVSARHWFTLERLEIHSNGSIASFNASQVTGPSIYSFHCEYVNSHNKNGDLLVPSTQPSLWQLTFQDFQIQAFNVTGERFSYASDCAGFFSPGIWMGLLTSLFMLFIFTYGLHMILGLKTMDRFDDHKGPTIALTQIV

Entity 13 Entity 13 polymer

Description description	V-type proton ATPase subunit
Molecular weight formula_weight	40369.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF

Entity 14 Entity 14 polymer

Description description	V-type proton ATPase subunit
Molecular weight formula_weight	9343.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

MAYTGLTVPLIVMSVFWGFVGFLVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLNPLFGPQLKNETIWYLKYHWP

Entity 15 Entity 15 polymer

Description description	Ribonuclease kappa
Molecular weight formula_weight	11016.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

MASLLCCGPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKDFENGPQDIYKLYEQVSYNCFIAAGLYLLLGGFSFCQVRLNKRKEYMVR

Entity 16 Entity 16 polymer

Description description	V-type proton ATPase proteolipid subunit
Molecular weight formula_weight	15639.7 kDa
Source method src_method	nat
Copy count entity_count	9

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g,h,i,j,k,l,m,n,o

MSEAKSGPEYAAFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANSLTEGISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK

Entity 17 Entity 17 polymer

Description description	ATPase H(+)-transporting lysosomal accessory protein 2
Molecular weight formula_weight	39200.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p

MAVLVALLSLVVAGVLGNEFSILRSPGSVVFRDGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVDKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRSRLFQENSILSLLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYNLYGGNAVVELVTVRSFDTSLVRKTRTILEAKQVKDPPSPYNLAYKYNVDYPVVFNMILWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Entity 18 Entity 18 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	14746

Structure of porcine kidney V-ATPase with SidK, Rotary State 2

1. Protein Identity and Related Structures Protein Identity & Related Structures

V-type proton ATPase catalytic subunit A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Vacuolar proton pump subunit B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit C

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit D

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit E 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit F

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit G

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Bacterial effector protein SidK

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit H

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit a

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer