7u8r

Structure of porcine kidney V-ATPase with SidK, Rotary State 3

Method: ELECTRON MICROSCOPY D_max: 210.3 Å Quality: EXCELLENT

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

V-type proton ATPase catalytic subunit A

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 35 PDB declaration: 35-meric（35） Consistent with protein copy count	Chain A； UniProt 1–617 Chain B； UniProt 1–617 Chain C； UniProt 1–617	Not recorded	Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit F × 1 （F1SMN6） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1UJS8） V-type proton ATPase subunit × 1 （A0A4X1U843） Ribonuclease kappa × 1 （A0A480L8C4） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.80 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7U8R	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7U8O Structure of porcine V-ATPase with mEAK7 and SidK, Rotary state 2 Deposited 2022-03-09	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain A 1–617（617 aa） Chain B 1–617（617 aa） Chain C 1–617（617 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7U8P Structure of porcine kidney V-ATPase with SidK, Rotary State 1 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain A 1–617（617 aa） Chain B 1–617（617 aa） Chain C 1–617（617 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
7U8Q Structure of porcine kidney V-ATPase with SidK, Rotary State 2 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain A 1–617（617 aa） Chain B 1–617（617 aa） Chain C 1–617（617 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	VATA_PIG
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–617； UniProt 1–617 Author chain B； PDBConstruct 1–617； UniProt 1–617 Author chain C； PDBConstruct 1–617； UniProt 1–617

Vacuolar proton pump subunit B

OrganismNot specified

UniProt A0A4X1W9K3

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 35 PDB declaration: 35-meric（35） Consistent with protein copy count	Chain D； UniProt 1–515 Chain E； UniProt 1–515 Chain F； UniProt 1–515	Not recorded	V-type proton ATPase catalytic subunit A × 3 （Q29048） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit F × 1 （F1SMN6） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1UJS8） V-type proton ATPase subunit × 1 （A0A4X1U843） Ribonuclease kappa × 1 （A0A480L8C4） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.80 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7U8R	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7U8O Structure of porcine V-ATPase with mEAK7 and SidK, Rotary state 2 Deposited 2022-03-09	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain D 1–515（515 aa） Chain E 1–515（515 aa） Chain F 1–515（515 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7U8P Structure of porcine kidney V-ATPase with SidK, Rotary State 1 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain D 1–515（515 aa） Chain E 1–515（515 aa） Chain F 1–515（515 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
7U8Q Structure of porcine kidney V-ATPase with SidK, Rotary State 2 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain D 1–515（515 aa） Chain E 1–515（515 aa） Chain F 1–515（515 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A4X1W9K3_PIG
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–515； UniProt 1–515 Author chain E； PDBConstruct 1–515； UniProt 1–515 Author chain F； PDBConstruct 1–515； UniProt 1–515

V-type proton ATPase subunit C

OrganismNot specified

UniProt F1S0R4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 35 PDB declaration: 35-meric（35） Consistent with protein copy count	Chain G； UniProt 1–382	Not recorded	V-type proton ATPase catalytic subunit A × 3 （Q29048） Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit F × 1 （F1SMN6） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1UJS8） V-type proton ATPase subunit × 1 （A0A4X1U843） Ribonuclease kappa × 1 （A0A480L8C4） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.80 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7U8R	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7U8O Structure of porcine V-ATPase with mEAK7 and SidK, Rotary state 2 Deposited 2022-03-09	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain G 1–382（382 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7U8P Structure of porcine kidney V-ATPase with SidK, Rotary State 1 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain G 1–382（382 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
7U8Q Structure of porcine kidney V-ATPase with SidK, Rotary State 2 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain G 1–382（382 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1S0R4_PIG
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain G； PDBConstruct 1–382； UniProt 1–382

V-type proton ATPase subunit D

OrganismNot specified

UniProt A0A286ZJL5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 35 PDB declaration: 35-meric（35） Consistent with protein copy count	Chain H； UniProt 1–247	Not recorded	V-type proton ATPase catalytic subunit A × 3 （Q29048） Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit F × 1 （F1SMN6） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1UJS8） V-type proton ATPase subunit × 1 （A0A4X1U843） Ribonuclease kappa × 1 （A0A480L8C4） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.80 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7U8R	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7U8O Structure of porcine V-ATPase with mEAK7 and SidK, Rotary state 2 Deposited 2022-03-09	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain H 1–247（247 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7U8P Structure of porcine kidney V-ATPase with SidK, Rotary State 1 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain H 1–247（247 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
7U8Q Structure of porcine kidney V-ATPase with SidK, Rotary State 2 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain H 1–247（247 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A286ZJL5_PIG
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain H； PDBConstruct 1–247； UniProt 1–247

V-type proton ATPase subunit E 1

OrganismNot specified

UniProt K9J4U3

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 35 PDB declaration: 35-meric（35） Consistent with protein copy count	Chain I； UniProt 1–226 Chain J； UniProt 1–226 Chain K； UniProt 1–226	Not recorded	V-type proton ATPase catalytic subunit A × 3 （Q29048） Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit F × 1 （F1SMN6） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1UJS8） V-type proton ATPase subunit × 1 （A0A4X1U843） Ribonuclease kappa × 1 （A0A480L8C4） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.80 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7U8R	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7U8O Structure of porcine V-ATPase with mEAK7 and SidK, Rotary state 2 Deposited 2022-03-09	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain I 1–226（226 aa） Chain J 1–226（226 aa） Chain K 1–226（226 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7U8P Structure of porcine kidney V-ATPase with SidK, Rotary State 1 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain I 1–226（226 aa） Chain J 1–226（226 aa） Chain K 1–226（226 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
7U8Q Structure of porcine kidney V-ATPase with SidK, Rotary State 2 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain I 1–226（226 aa） Chain J 1–226（226 aa） Chain K 1–226（226 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	K9J4U3_PIG
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain I； PDBConstruct 1–226； UniProt 1–226 Author chain J； PDBConstruct 1–226； UniProt 1–226 Author chain K； PDBConstruct 1–226； UniProt 1–226

V-type proton ATPase subunit F

OrganismNot specified

UniProt F1SMN6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 35 PDB declaration: 35-meric（35） Consistent with protein copy count	Chain L； UniProt 1–119	Not recorded	V-type proton ATPase catalytic subunit A × 3 （Q29048） Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1UJS8） V-type proton ATPase subunit × 1 （A0A4X1U843） Ribonuclease kappa × 1 （A0A480L8C4） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.80 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7U8R	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7U8O Structure of porcine V-ATPase with mEAK7 and SidK, Rotary state 2 Deposited 2022-03-09	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain L 1–119（119 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7U8P Structure of porcine kidney V-ATPase with SidK, Rotary State 1 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain L 1–119（119 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
7U8Q Structure of porcine kidney V-ATPase with SidK, Rotary State 2 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain L 1–119（119 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1SMN6_PIG
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain L； PDBConstruct 1–119； UniProt 1–119

V-type proton ATPase subunit G

OrganismNot specified

UniProt A0A4X1UZN2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 35 PDB declaration: 35-meric（35） Consistent with protein copy count	Chain M； UniProt 1–118 Chain N； UniProt 1–118 Chain O； UniProt 1–118	Not recorded	V-type proton ATPase catalytic subunit A × 3 （Q29048） Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit F × 1 （F1SMN6） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1UJS8） V-type proton ATPase subunit × 1 （A0A4X1U843） Ribonuclease kappa × 1 （A0A480L8C4） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.80 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7U8R	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7U8O Structure of porcine V-ATPase with mEAK7 and SidK, Rotary state 2 Deposited 2022-03-09	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain M 1–118（118 aa） Chain N 1–118（118 aa） Chain O 1–118（118 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7U8P Structure of porcine kidney V-ATPase with SidK, Rotary State 1 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain M 1–118（118 aa） Chain N 1–118（118 aa） Chain O 1–118（118 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
7U8Q Structure of porcine kidney V-ATPase with SidK, Rotary State 2 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain M 1–118（118 aa） Chain N 1–118（118 aa） Chain O 1–118（118 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A4X1UZN2_PIG
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain M； PDBConstruct 1–118； UniProt 1–118 Author chain N； PDBConstruct 1–118； UniProt 1–118 Author chain O； PDBConstruct 1–118； UniProt 1–118

Bacterial effector protein SidK

Legionella pneumophila

UniProt Q5ZWW6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 35 PDB declaration: 35-meric（35） Consistent with protein copy count	Chain Q； UniProt 1–337 Chain R； UniProt 1–337 Chain S； UniProt 1–337	Not recorded	V-type proton ATPase catalytic subunit A × 3 （Q29048） Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit F × 1 （F1SMN6） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1UJS8） V-type proton ATPase subunit × 1 （A0A4X1U843） Ribonuclease kappa × 1 （A0A480L8C4） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.80 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7U8R	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6VQ6 Mammalian V-ATPase from rat brain - composite model of rotational state 1 bound to ADP and SidK (built from focused refinement models) Deposited 2020-02-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 34 PDB declaration: 34-meric	Chain Q 1–278（278 aa） Fragment：N-terminal fragment with 3x FLAG tag Chain R 1–278（278 aa） Fragment：N-terminal fragment with 3x FLAG tag Chain S 1–278（278 aa） Fragment：N-terminal fragment with 3x FLAG tag	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
6VQ7 Mammalian V-ATPase from rat brain - composite model of rotational state 2 bound to ADP and SidK (built from focused refinement models) Deposited 2020-02-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 34 PDB declaration: 34-meric	Chain Q 1–278（278 aa） Fragment：N-terminal fragment with 3x FLAG tag Chain R 1–278（278 aa） Fragment：N-terminal fragment with 3x FLAG tag Chain S 1–278（278 aa） Fragment：N-terminal fragment with 3x FLAG tag	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.00 Å
6VQ8 Mammalian V-ATPase from rat brain - composite model of rotational state 3 bound to ADP and SidK (built from focused refinement models) Deposited 2020-02-04	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 34 PDB declaration: 34-meric	Chain Q 1–278（278 aa） Fragment：N-terminal fragment with 3x FLAG tag Chain R 1–278（278 aa） Fragment：N-terminal fragment with 3x FLAG tag Chain S 1–278（278 aa） Fragment：N-terminal fragment with 3x FLAG tag	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
6VQ9 Mammalian V-ATPase from rat brain soluble V1 region rotational state 1 with SidK and ADP (from focused refinement) Deposited 2020-02-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain Q 1–278（278 aa） Fragment：N-terminal fragment with 3x FLAG tag Chain R 1–278（278 aa） Fragment：N-terminal fragment with 3x FLAG tag Chain S 1–278（278 aa） Fragment：N-terminal fragment with 3x FLAG tag	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
6VQA Mammalian V-ATPase from rat brain soluble V1 region rotational state 2 with SidK and ADP (from focused refinement) Deposited 2020-02-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain Q 1–278（278 aa） Fragment：N-terminal fragment with 3x FLAG tag Chain R 1–278（278 aa） Fragment：N-terminal fragment with 3x FLAG tag Chain S 1–278（278 aa） Fragment：N-terminal fragment with 3x FLAG tag	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.70 Å
6VQB Mammalian V-ATPase from rat brain soluble V1 region rotational state 2 with SidK and ADP (from focused refinement) Deposited 2020-02-04	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain Q 1–278（278 aa） Chain R 1–278（278 aa） Chain S 1–278（278 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
6WLZ The V1 region of human V-ATPase in state 1 (focused refinement) Deposited 2020-04-20	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 17 PDB declaration: heptadecameric	Chain X 1–573（573 aa） Chain Y 1–573（573 aa） Chain Z 1–573（573 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
6WM3 Human V-ATPase in state 2 with SidK and ADP Deposited 2020-04-20	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain X 1–573（573 aa） Chain Y 1–573（573 aa） Chain Z 1–573（573 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 8 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
7U4T Human V-ATPase in state 2 with SidK and mEAK-7 Deposited 2022-03-01	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain X 1–573（573 aa） Chain Y 1–573（573 aa） Chain Z 1–573（573 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 8 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7U8O Structure of porcine V-ATPase with mEAK7 and SidK, Rotary state 2 Deposited 2022-03-09	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain Q 1–337（337 aa） Chain R 1–337（337 aa） Chain S 1–337（337 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7U8P Structure of porcine kidney V-ATPase with SidK, Rotary State 1 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain Q 1–337（337 aa） Chain R 1–337（337 aa） Chain S 1–337（337 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
7U8Q Structure of porcine kidney V-ATPase with SidK, Rotary State 2 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain Q 1–337（337 aa） Chain R 1–337（337 aa） Chain S 1–337（337 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
7UZF Rat Kidney V-ATPase with SidK, State 1 Deposited 2022-05-09	Different construct Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain Q 1–280（280 aa） Chain R 1–280（280 aa） Chain S 1–280（280 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.80 Å
7UZG Rat Kidney V-ATPase lacking subunit H, with SidK and NCOA7B, State 1 Deposited 2022-05-09	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain Q 1–278（278 aa） Chain R 1–278（278 aa） Chain S 1–278（278 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.70 Å
7UZH Rat Kidney V-ATPase with SidK, State 2 Deposited 2022-05-09	Different construct Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain Q 1–278（278 aa） Chain R 1–278（278 aa） Chain S 1–278（278 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.80 Å
7UZI Rat Kidney V-ATPase lacking subunit H, with SidK and NCOA7B, State 2 Deposited 2022-05-09	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain Q 1–278（278 aa） Chain R 1–278（278 aa） Chain S 1–278（278 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
7UZJ Rat Kidney V1 complex with SidK and NCOA7B, State 1 Deposited 2022-05-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain Q 1–280（280 aa） Chain R 1–280（280 aa） Chain S 1–280（280 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
7UZK Rat Kidney V1 complex lacking subunit H with SidK and NCOA7B, State 1 Deposited 2022-05-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain Q 1–280（280 aa） Chain R 1–280（280 aa） Chain S 1–280（280 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9B8P Synaptic Vesicle V-ATPase with synaptophysin and SidK, State 3, V1 Deposited 2024-03-31	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 17 PDB declaration: heptadecameric	Chain Q 1–573（573 aa） Chain R 1–573（573 aa） Chain S 1–573（573 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9BRB Synaptic Vesicle V-ATPase with synaptophysin and SidK, State 1 Deposited 2024-05-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain Q 1–573（573 aa） Chain R 1–573（573 aa） Chain S 1–573（573 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9BRC Synaptic Vesicle V-ATPase with synaptophysin and SidK, State 2 Deposited 2024-05-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain Q 1–573（573 aa） Chain R 1–573（573 aa） Chain S 1–573（573 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
9BRD Synaptic Vesicle V-ATPase with synaptophysin and SidK, State 3 Deposited 2024-05-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 36 PDB declaration: 36-meric	Chain Q 1–573（573 aa） Chain R 1–573（573 aa） Chain S 1–573（573 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 PTY PHOSPHATIDYLETHANOLAMINE × 9 WJP methyl (3R,6Z,10E,14E)-3,7,11,15,19-pentamethylicosa-6,10,14,18-tetraen-1-yl dihydrogen diphosphate × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 LP3 (7R)-4,7-DIHYDROXY-N,N,N-TRIMETHYL-10-OXO-3,5,9-TRIOXA-4-PHOSPHAHEPTACOSAN-1-AMINIUM 4-OXIDE × 1 CLR CHOLESTEROL × 30	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å

22 other PDB entries and 22 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q5ZWW6_LEGPH
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain Q； PDBConstruct 1–337； UniProt 1–337 Author chain R； PDBConstruct 1–337； UniProt 1–337 Author chain S； PDBConstruct 1–337； UniProt 1–337

V-type proton ATPase subunit H

OrganismNot specified

UniProt Q9TVC1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 35 PDB declaration: 35-meric（35） Consistent with protein copy count	Chain T； UniProt 1–483	Not recorded	V-type proton ATPase catalytic subunit A × 3 （Q29048） Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit F × 1 （F1SMN6） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1UJS8） V-type proton ATPase subunit × 1 （A0A4X1U843） Ribonuclease kappa × 1 （A0A480L8C4） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.80 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7U8R	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7U8O Structure of porcine V-ATPase with mEAK7 and SidK, Rotary state 2 Deposited 2022-03-09	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain T 1–483（483 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7U8P Structure of porcine kidney V-ATPase with SidK, Rotary State 1 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain T 1–483（483 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
7U8Q Structure of porcine kidney V-ATPase with SidK, Rotary State 2 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain T 1–483（483 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	VATH_PIG
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain T； PDBConstruct 1–483； UniProt 1–483

V-type proton ATPase subunit a

OrganismNot specified

UniProt A0A4X1U3K4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 35 PDB declaration: 35-meric（35） Consistent with protein copy count	Chain a； UniProt 1–838	Not recorded	V-type proton ATPase catalytic subunit A × 3 （Q29048） Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit F × 1 （F1SMN6） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1UJS8） V-type proton ATPase subunit × 1 （A0A4X1U843） Ribonuclease kappa × 1 （A0A480L8C4） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.80 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7U8R	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7U8O Structure of porcine V-ATPase with mEAK7 and SidK, Rotary state 2 Deposited 2022-03-09	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain a 1–838（838 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7U8P Structure of porcine kidney V-ATPase with SidK, Rotary State 1 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain a 1–838（838 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
7U8Q Structure of porcine kidney V-ATPase with SidK, Rotary State 2 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain a 1–838（838 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A4X1U3K4_PIG
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain a； PDBConstruct 1–838； UniProt 1–838

V-type proton ATPase 21 kDa proteolipid subunit isoform 1

OrganismNot specified

UniProt A0A480L444

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 35 PDB declaration: 35-meric（35） Consistent with protein copy count	Chain b； UniProt 1–205	Not recorded	V-type proton ATPase catalytic subunit A × 3 （Q29048） Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit F × 1 （F1SMN6） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1UJS8） V-type proton ATPase subunit × 1 （A0A4X1U843） Ribonuclease kappa × 1 （A0A480L8C4） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.80 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7U8R	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7U8O Structure of porcine V-ATPase with mEAK7 and SidK, Rotary state 2 Deposited 2022-03-09	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain b 1–205（205 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7U8P Structure of porcine kidney V-ATPase with SidK, Rotary State 1 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain b 1–205（205 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
7U8Q Structure of porcine kidney V-ATPase with SidK, Rotary State 2 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain b 1–205（205 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A480L444_PIG
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain b； PDBConstruct 1–205； UniProt 1–205

ATPase H+ transporting accessory protein 1

OrganismNot specified

UniProt K9IWA3

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 35 PDB declaration: 35-meric（35） Consistent with protein copy count	Chain c； UniProt 1–469	Not recorded	V-type proton ATPase catalytic subunit A × 3 （Q29048） Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit F × 1 （F1SMN6） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） V-type proton ATPase subunit × 1 （A0A4X1UJS8） V-type proton ATPase subunit × 1 （A0A4X1U843） Ribonuclease kappa × 1 （A0A480L8C4） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.80 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7U8R	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7U8O Structure of porcine V-ATPase with mEAK7 and SidK, Rotary state 2 Deposited 2022-03-09	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain c 1–469（469 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7U8P Structure of porcine kidney V-ATPase with SidK, Rotary State 1 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain c 1–469（469 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
7U8Q Structure of porcine kidney V-ATPase with SidK, Rotary State 2 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain c 1–469（469 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	K9IWA3_PIG
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain c； PDBConstruct 1–469； UniProt 1–469

V-type proton ATPase subunit

OrganismNot specified

UniProt A0A4X1UJS8

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 35 PDB declaration: 35-meric（35） Consistent with protein copy count	Chain d； UniProt 1–351	Not recorded	V-type proton ATPase catalytic subunit A × 3 （Q29048） Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit F × 1 （F1SMN6） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1U843） Ribonuclease kappa × 1 （A0A480L8C4） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.80 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7U8R	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7U8O Structure of porcine V-ATPase with mEAK7 and SidK, Rotary state 2 Deposited 2022-03-09	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain d 1–351（351 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7U8P Structure of porcine kidney V-ATPase with SidK, Rotary State 1 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain d 1–351（351 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
7U8Q Structure of porcine kidney V-ATPase with SidK, Rotary State 2 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain d 1–351（351 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A4X1UJS8_PIG
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain d； PDBConstruct 1–351； UniProt 1–351

V-type proton ATPase subunit

OrganismNot specified

UniProt A0A4X1U843

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 35 PDB declaration: 35-meric（35） Consistent with protein copy count	Chain e； UniProt 1–81	Not recorded	V-type proton ATPase catalytic subunit A × 3 （Q29048） Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit F × 1 （F1SMN6） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1UJS8） Ribonuclease kappa × 1 （A0A480L8C4） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.80 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7U8R	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7U8O Structure of porcine V-ATPase with mEAK7 and SidK, Rotary state 2 Deposited 2022-03-09	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain e 1–81（81 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7U8P Structure of porcine kidney V-ATPase with SidK, Rotary State 1 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain e 1–81（81 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
7U8Q Structure of porcine kidney V-ATPase with SidK, Rotary State 2 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain e 1–81（81 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A4X1U843_PIG
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain e； PDBConstruct 1–81； UniProt 1–81

Ribonuclease kappa

OrganismNot specified

UniProt A0A480L8C4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 35 PDB declaration: 35-meric（35） Consistent with protein copy count	Chain f； UniProt 118–215	Not recorded	V-type proton ATPase catalytic subunit A × 3 （Q29048） Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit F × 1 （F1SMN6） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1UJS8） V-type proton ATPase subunit × 1 （A0A4X1U843） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.80 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7U8R	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7U8O Structure of porcine V-ATPase with mEAK7 and SidK, Rotary state 2 Deposited 2022-03-09	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain f 118–215（98 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7U8P Structure of porcine kidney V-ATPase with SidK, Rotary State 1 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain f 118–215（98 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
7U8Q Structure of porcine kidney V-ATPase with SidK, Rotary State 2 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain f 118–215（98 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A480L8C4_PIG
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain f； PDBConstruct 1–98； UniProt 118–215

V-type proton ATPase proteolipid subunit

OrganismNot specified

UniProt A0A4X1VUN6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 35 PDB declaration: 35-meric（35） Consistent with protein copy count	Chain g； UniProt 1–155 Chain h； UniProt 1–155 Chain i； UniProt 1–155 Chain j； UniProt 1–155 Chain k； UniProt 1–155 Chain l； UniProt 1–155 Chain m； UniProt 1–155 Chain n； UniProt 1–155 Chain o； UniProt 1–155	Not recorded	V-type proton ATPase catalytic subunit A × 3 （Q29048） Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit F × 1 （F1SMN6） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1UJS8） V-type proton ATPase subunit × 1 （A0A4X1U843） Ribonuclease kappa × 1 （A0A480L8C4） ATPase H(+)-transporting lysosomal accessory protein 2 × 1 （A0A287AJK1） ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.80 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7U8R	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7U8O Structure of porcine V-ATPase with mEAK7 and SidK, Rotary state 2 Deposited 2022-03-09	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain g 1–155（155 aa） Chain h 1–155（155 aa） Chain i 1–155（155 aa） Chain j 1–155（155 aa） Chain k 1–155（155 aa） Chain l 1–155（155 aa） Chain m 1–155（155 aa） Chain n 1–155（155 aa） Chain o 1–155（155 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7U8P Structure of porcine kidney V-ATPase with SidK, Rotary State 1 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain g 1–155（155 aa） Chain h 1–155（155 aa） Chain i 1–155（155 aa） Chain j 1–155（155 aa） Chain k 1–155（155 aa） Chain l 1–155（155 aa） Chain m 1–155（155 aa） Chain n 1–155（155 aa） Chain o 1–155（155 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
7U8Q Structure of porcine kidney V-ATPase with SidK, Rotary State 2 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain g 1–155（155 aa） Chain h 1–155（155 aa） Chain i 1–155（155 aa） Chain j 1–155（155 aa） Chain k 1–155（155 aa） Chain l 1–155（155 aa） Chain m 1–155（155 aa） Chain n 1–155（155 aa） Chain o 1–155（155 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A4X1VUN6_PIG
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain g； PDBConstruct 1–155； UniProt 1–155 Author chain h； PDBConstruct 1–155； UniProt 1–155 Author chain i； PDBConstruct 1–155； UniProt 1–155 Author chain j； PDBConstruct 1–155； UniProt 1–155 Author chain k； PDBConstruct 1–155； UniProt 1–155 Author chain l； PDBConstruct 1–155； UniProt 1–155 Author chain m； PDBConstruct 1–155； UniProt 1–155 Author chain n； PDBConstruct 1–155； UniProt 1–155 Author chain o； PDBConstruct 1–155； UniProt 1–155

ATPase H(+)-transporting lysosomal accessory protein 2

OrganismNot specified

UniProt A0A287AJK1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 35 PDB declaration: 35-meric（35） Consistent with protein copy count	Chain p； UniProt 1–351	Not recorded	V-type proton ATPase catalytic subunit A × 3 （Q29048） Vacuolar proton pump subunit B × 3 （A0A4X1W9K3） V-type proton ATPase subunit C × 1 （F1S0R4） V-type proton ATPase subunit D × 1 （A0A286ZJL5） V-type proton ATPase subunit E 1 × 3 （K9J4U3） V-type proton ATPase subunit F × 1 （F1SMN6） V-type proton ATPase subunit G × 3 （A0A4X1UZN2） Bacterial effector protein SidK × 3 （Q5ZWW6） V-type proton ATPase subunit H × 1 （Q9TVC1） V-type proton ATPase subunit a × 1 （A0A4X1U3K4） V-type proton ATPase 21 kDa proteolipid subunit isoform 1 × 1 （A0A480L444） ATPase H+ transporting accessory protein 1 × 1 （K9IWA3） V-type proton ATPase subunit × 1 （A0A4X1UJS8） V-type proton ATPase subunit × 1 （A0A4X1U843） Ribonuclease kappa × 1 （A0A480L8C4） V-type proton ATPase proteolipid subunit × 9 （A0A4X1VUN6） ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.80 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7U8R	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7U8O Structure of porcine V-ATPase with mEAK7 and SidK, Rotary state 2 Deposited 2022-03-09	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain p 1–351（351 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7U8P Structure of porcine kidney V-ATPase with SidK, Rotary State 1 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain p 1–351（351 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
7U8Q Structure of porcine kidney V-ATPase with SidK, Rotary State 2 Deposited 2022-03-09	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain p 1–351（351 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A287AJK1_PIG
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain p； PDBConstruct 1–351； UniProt 1–351

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7u8r
Deposition date deposition_date	2022-03-09
Structure title title	Structure of porcine kidney V-ATPase with SidK, Rotary State 3
Keywords keywords	proton translocation, complex, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	79.41 Å
Radius of gyration Rg (electron density) rg_electron	78.01 Å
Forward intensity I(0) i0	11878700000.00
Molecular weight molecular_weight	887850.0 kDa
Excluded volume excluded_volume	1094100 Å³
Envelope volume envelope_volume	1830500 Å³
Hydration-shell volume shell_volume	193280 Å³
Envelope diameter envelope_diameter	279.8 Å
Shell Rg shell_rg	77.58 Å
Envelope Rg envelope_rg	77.26 Å
Shape Rg shape_rg	78.21 Å
Total Rg total_rg	77.33 Å
Total atoms total_atoms	62638
Residues n_residues	8978
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	210.3 Å
Rg (real space) rg_real	76.20 Å
Rg uncertainty (real space) rg_real_error	0.69 Å
I(0) (real space) i0_real	1.1440e+10
I(0) uncertainty (real space) i0_real_error	2.1390e+08
Rg (reciprocal space) rg_reciprocal	78.40 Å
I(0) (reciprocal space) i0_reciprocal	11850000000.0000
Solution quality estimate total_estimate	0.9152
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	84.1 Å
Skewness Skewness skewness	0.308
Kurtosis Kurtosis kurtosis	-0.642
Angular range angular_range	— – 0.1000 Å⁻¹
Current regularization parameter α current_alpha	0.3926
Highest regularization parameter α highest_alpha	1646000000.0000
Real-space data points n_real_points	21
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.989; Stabil: 0.984; Sysdev: 1.000; Positv: 1.000; Valcen: 1.000; Smooth: 0.006

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (18)

Entity 1 Entity 1 polymer

Description description	V-type proton ATPase catalytic subunit A
Molecular weight formula_weight	68393.8 kDa
EC 编号 ec_number	7.1.2.2
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	62638

MDFSKLPKILDEDKESTFGYVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPRGVNVSALSRDVKWEFTPSKNLRVGSHITGGDIYGIVNENSLIKHRIMLPPRNRGTVTYIAPPGNYDTSDVVLELEFEGVKEKFSMVQVWPVRQVRPVTEKLPANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERVNEMSEVLRDFPELTMEVDGKVESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYHVSMMANSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNPEREGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSVNWLISYSKYMRALDEYYDKHFTEFVPLRTKAKEILQEEEDLAEIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMIAFYDLARRAVETTAQSDNKITWSIIREHMGEILYKLSSMKFKDPVKDGEAKIKADYAQLLEDVQNAFRSLED

Entity 2 Entity 2 polymer

Description description	Vacuolar proton pump subunit B
Molecular weight formula_weight	57162.9 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F

MAMKVDSRPGGLPSSGSHLGTAREHVQAVTRNYITHPRVTYRTVCSVNGPLVVLDHVKFAQYAEIVNFTLPNGTQRSGQVLEVSGTKAIVQVFEGTSGIDAQKTTCEFTGDILRTPVSEDMLGRVFNGSGKPIDNGPVVMAEDFLDINGQPINPHDRIYPEEMIQTGISPIDVMNSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKKSKAVLDYDDDNFAIVFAAMGVNMETARFFKSDFEENGTMGNVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRGGSITQIPILTMPNDDITHPIPDLTGFITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHGDVSNQLYACYAIGKDVQAMKAVVGEEALTSEDLLYLEFLQKFERNFINQGPYEKRSVFESLDLGWKLLRIFPKEMLKRIPQSMIDEFYSREGAPQDPEPEPDTAL

Entity 3 Entity 3 polymer

Description description	V-type proton ATPase subunit C
Molecular weight formula_weight	44066.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MTEFWLISAPGEKTCQQTWEKLHAATTKNNNLALTSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLYELYKHLDSSAAAIIDAPVDIPGLNLSQQEYYPYVYYKIDCNLLEFK

Entity 4 Entity 4 polymer

Description description	V-type proton ATPase subunit D
Molecular weight formula_weight	28301.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRLKKIQEKKKILKEKSEKDLEQRRAAGEAMEPANLLAEEKDEDLLFE

Entity 5 Entity 5 polymer

Description description	V-type proton ATPase subunit E 1
Molecular weight formula_weight	26162.4 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J,K

MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLGKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPVYKIATKRDVDVQIDQEAYLPEEIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD

Entity 6 Entity 6 polymer

Description description	V-type proton ATPase subunit F
Molecular weight formula_weight	13403.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNREDIGIILINQYIAEMVRHALDAHQRSIPAVLEIPSKEHPYDAAKDSILRRAKGMFTAEDLR

Entity 7 Entity 7 polymer

Description description	V-type proton ATPase subunit G
Molecular weight formula_weight	13748.5 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,N,O

MASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKAKEAAALGSHGSCSTEVEKDTQEKMTILQTYFRQNRDEVLDNLLAFVCDIRPEIHENYRING

Entity 8 Entity 8 polymer

Description description	Bacterial effector protein SidK
Molecular weight formula_weight	38539.4 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q,R,S

MSFIKVGIKMGGLTSEQYHSQVVGKIGYIARCMQTIDPENNLKKIREDYQDVLIWAEKNYRFEEILEASKSGKCPNDLDALSRRSLILQELLRLVSSISPFKMKLDLIESQYEKMKQHVNLWKSDYHVKLNQLNQLTDYLKNAAPTPKNNFLRAMTSVLQMQIAQYGITEDNEGINQLFKLGLHLLAMANEKIDEQYHLFKGYVKDQPEESPFEGILPAEDQKILVKTMIDYAMPKLSSKVLQDKLSALSSSDVLTKTLLDSIDRIVKENEKLNALSKVKLGKFGLDIREIEVIYSQALKISPQDALQYTAQQCDAQLLSMAFPDSQNYIIESISNK

来源 Source

来源生物 organism	Legionella pneumophila
NCBI Class编号 ncbi_taxonomy_id	446
宿主生物 host_organism	Escherichia coli

Entity 9 Entity 9 polymer

Description description	V-type proton ATPase subunit H
Molecular weight formula_weight	55917.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MTKMDIRGAVDAAVPTNIIAAKAAEVRANKVNWQSYLQGQMISSEDCEFIQRFEMKRSPEEKQEMLQTEGSQCAKTFINLMTHISKEQTVQYILTMVDDTLQENHQRVSIFFDYAKRSKNTAWSYFLPMLNRQDLFTVHMAARIIAKLAAWGKELMEGSDLNYYFNWIKTQLASQKLRGSGVAVETGTVSSSDSSQYVQCVAGCLQLMLRVNEYRFAWVEADGVNCIMGVLSNKCGFQLQYQMIFSIWLLAFSPQMCEHLRRYNIIPVLSDILQESVKEKVTRIILAAFRNFLEKSTERETRQEYALALIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQSEQPQTAAARS

Entity 10 Entity 10 polymer

Description description	V-type proton ATPase subunit a
Molecular weight formula_weight	96365.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELKFILRKTQQFFDEMADPDLLEESSSLLEPNEMGRGTPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVTDLDSIQFALRRGTEHSGSTVPSILNRMQTNQTPPTYNKTNKFTCGFQNIVDAYGIGTYREINPAPYTIITFPFLFAVMFGDFGHGILMTLFAVWMVLRESRILSQKNENEMFSTVFSGRYIILLMGIFSIYTGLIYNDCFSKSLNIFGSSWSVRPMFDGYNWTEETLRGNPVLQLNPAVLGVFGGPYPFGIDPIWNIATNKLTFLNSFKMKMSVILGIIHMMFGVSLSLFNHIYFKRPLNIYFGFIPEIIFMTSLFGYLVILIFYKWTAYDAQTSEKAPSLLIHFINMFLFSYGDSGNSMLYSGQKGIQCFLVVVALLCVPWMLLIKPLVLRHQYLRRKHLGTLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVIHIGLSVKSLAGGLALFFIFAAFATLTVAILLIMEGLSAFLHALRLHWVEFQNKFYSGTGFKFLPFSFEHIREGKFDE

Entity 11 Entity 11 polymer

Description description	V-type proton ATPase 21 kDa proteolipid subunit isoform 1
Molecular weight formula_weight	21530.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MTGLVLLYSGVFVAFWACLLVVGICYTIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVAILQTSRVKMGD

Entity 12 Entity 12 polymer

Description description	ATPase H+ transporting accessory protein 1
Molecular weight formula_weight	51547.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MMAAAAAARVRAGTRRGPALWQMPWLPLVAVAVVAAASAAEQQVPLVLWSSDRNLWAPAANTHEGHITSDRQLSTYLDPALELGPRNVLLFLQDKLSVEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAVSTLTTYLQEKLGASPLHVDLATLRELKLNASLPALLLIRLPYTASSGLMAPKEVLTANDEVIGQVLSTLKSEEVPYTAALTAVRPSRVARDVAMVAGGLGRQLLQRPSASAATHPPVSYNDTAPRILFWAQNFSVAYGGRWEDLTSLTFGVQDLNLTGSFWNDSVAWLALTYDQLFGTMVTFKFILANRFYQVSARHWFTLERLEIHSNGSIASFNASQVTGPSIYSFHCEYVNSHNKNGDLLVPSTQPSLWQLTFQDFQIQAFNVTGERFSYASDCAGFFSPGIWMGLLTSLFMLFIFTYGLHMILGLKTMDRFDDHKGPTIALTQIV

Entity 13 Entity 13 polymer

Description description	V-type proton ATPase subunit
Molecular weight formula_weight	40369.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF

Entity 14 Entity 14 polymer

Description description	V-type proton ATPase subunit
Molecular weight formula_weight	9343.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

MAYTGLTVPLIVMSVFWGFVGFLVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLNPLFGPQLKNETIWYLKYHWP

Entity 15 Entity 15 polymer

Description description	Ribonuclease kappa
Molecular weight formula_weight	11016.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

MASLLCCGPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKDFENGPQDIYKLYEQVSYNCFIAAGLYLLLGGFSFCQVRLNKRKEYMVR

Entity 16 Entity 16 polymer

Description description	V-type proton ATPase proteolipid subunit
Molecular weight formula_weight	15639.7 kDa
Source method src_method	nat
Copy count entity_count	9

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g,h,i,j,k,l,m,n,o

MSEAKSGPEYAAFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANSLTEGISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK

Entity 17 Entity 17 polymer

Description description	ATPase H(+)-transporting lysosomal accessory protein 2
Molecular weight formula_weight	39200.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p

MAVLVALLSLVVAGVLGNEFSILRSPGSVVFRDGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVDKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRSRLFQENSILSLLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYNLYGGNAVVELVTVRSFDTSLVRKTRTILEAKQVKDPPSPYNLAYKYNVDYPVVFNMILWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Entity 18 Entity 18 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	1

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.80 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	22866

fit	/app/data/saxs_computation/u8/7u8r/7u8r.fit
pddf	/app/data/pr_computation/u8/7u8r/7u8r.pr.out
profile	/app/data/saxs_computation/u8/7u8r/7u8r.dat

Structure of porcine kidney V-ATPase with SidK, Rotary State 3

1. Protein Identity and Related Structures Protein Identity & Related Structures

V-type proton ATPase catalytic subunit A

State in the Current Structure

Other States of the Same Protein in the Database

Vacuolar proton pump subunit B

State in the Current Structure

Other States of the Same Protein in the Database

V-type proton ATPase subunit C

State in the Current Structure

Other States of the Same Protein in the Database

V-type proton ATPase subunit D

State in the Current Structure

Other States of the Same Protein in the Database

V-type proton ATPase subunit E 1

State in the Current Structure

Other States of the Same Protein in the Database

V-type proton ATPase subunit F

State in the Current Structure

Other States of the Same Protein in the Database

V-type proton ATPase subunit G

State in the Current Structure

Other States of the Same Protein in the Database

Bacterial effector protein SidK

State in the Current Structure

Other States of the Same Protein in the Database

V-type proton ATPase subunit H

State in the Current Structure

Other States of the Same Protein in the Database

V-type proton ATPase subunit a

State in the Current Structure

Other States of the Same Protein in the Database

V-type proton ATPase 21 kDa proteolipid subunit isoform 1

State in the Current Structure

Other States of the Same Protein in the Database

ATPase H+ transporting accessory protein 1

State in the Current Structure

Other States of the Same Protein in the Database

V-type proton ATPase subunit

State in the Current Structure

Other States of the Same Protein in the Database

V-type proton ATPase subunit

State in the Current Structure

Other States of the Same Protein in the Database

Ribonuclease kappa

State in the Current Structure

Other States of the Same Protein in the Database

V-type proton ATPase proteolipid subunit

State in the Current Structure

Other States of the Same Protein in the Database

ATPase H(+)-transporting lysosomal accessory protein 2

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (18)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

来源 Source