7ueb

Photosynthetic assembly of Chlorobaculum tepidum (RC-FMO2)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem P840 reaction center, large subunit

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	Photosystem P840 reaction center iron-sulfur protein × 1 （Q8KAY1） Cytochrome c × 2 （O07091） P840 reaction center 17 kDa protein × 1 （Q8KEP5） PscE × 1 （Q8KDI3） PscF × 1 （Q8KG87） Bacteriochlorophyll a protein × 6 （Q46393） Bacteriochlorophyll A isomer × 2 Chlorophyll A ester × 4 BACTERIOCHLOROPHYLL A × 73 ;[(2R,3S,4S,5R,6R)-6-[(10E,12E,14E)-2,6,10,14,19,23-hexamethyl-25-(2,3,6-trimethylphenyl)pentacosa-6,8,10,12,14,16,18,20,22,24-decaen-2-yl]oxy-3,4,5-tris(oxidanyl)oxan-2-yl]methyl dodecanoate ; × 3 ;2-[(1E,3E,5E,7E,9E,11E,13E,15E,17E,19E)-3,7,12,16,20,24-hexamethylpentacosa-1,3,5,7,9,11,13,15,17,19,23-undecaenyl]-1,3,4-trimethyl-benzene ; × 3 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 10 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 6 IRON/SULFUR CLUSTER × 3 CALCIUM ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8KAY0_CHLTE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–731； UniProt 1–731 Author chain a； PDBConstruct 1–731； UniProt 1–731

Photosystem P840 reaction center iron-sulfur protein

OrganismNot specified

UniProt Q8KAY1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	Photosystem P840 reaction center, large subunit × 2 （Q8KAY0） Cytochrome c × 2 （O07091） P840 reaction center 17 kDa protein × 1 （Q8KEP5） PscE × 1 （Q8KDI3） PscF × 1 （Q8KG87） Bacteriochlorophyll a protein × 6 （Q46393） Bacteriochlorophyll A isomer × 2 Chlorophyll A ester × 4 BACTERIOCHLOROPHYLL A × 73 ;[(2R,3S,4S,5R,6R)-6-[(10E,12E,14E)-2,6,10,14,19,23-hexamethyl-25-(2,3,6-trimethylphenyl)pentacosa-6,8,10,12,14,16,18,20,22,24-decaen-2-yl]oxy-3,4,5-tris(oxidanyl)oxan-2-yl]methyl dodecanoate ; × 3 ;2-[(1E,3E,5E,7E,9E,11E,13E,15E,17E,19E)-3,7,12,16,20,24-hexamethylpentacosa-1,3,5,7,9,11,13,15,17,19,23-undecaenyl]-1,3,4-trimethyl-benzene ; × 3 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 10 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 6 IRON/SULFUR CLUSTER × 3 CALCIUM ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8KAY1_CHLTE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–231； UniProt 1–231

Cytochrome c

OrganismNot specified

UniProt O07091

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	Photosystem P840 reaction center, large subunit × 2 （Q8KAY0） Photosystem P840 reaction center iron-sulfur protein × 1 （Q8KAY1） P840 reaction center 17 kDa protein × 1 （Q8KEP5） PscE × 1 （Q8KDI3） PscF × 1 （Q8KG87） Bacteriochlorophyll a protein × 6 （Q46393） Bacteriochlorophyll A isomer × 2 Chlorophyll A ester × 4 BACTERIOCHLOROPHYLL A × 73 ;[(2R,3S,4S,5R,6R)-6-[(10E,12E,14E)-2,6,10,14,19,23-hexamethyl-25-(2,3,6-trimethylphenyl)pentacosa-6,8,10,12,14,16,18,20,22,24-decaen-2-yl]oxy-3,4,5-tris(oxidanyl)oxan-2-yl]methyl dodecanoate ; × 3 ;2-[(1E,3E,5E,7E,9E,11E,13E,15E,17E,19E)-3,7,12,16,20,24-hexamethylpentacosa-1,3,5,7,9,11,13,15,17,19,23-undecaenyl]-1,3,4-trimethyl-benzene ; × 3 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 10 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 6 IRON/SULFUR CLUSTER × 3 CALCIUM ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CY551_CHLTE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–206； UniProt 1–206 Author chain c； PDBConstruct 1–206； UniProt 1–206

P840 reaction center 17 kDa protein

OrganismNot specified

UniProt Q8KEP5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	Photosystem P840 reaction center, large subunit × 2 （Q8KAY0） Photosystem P840 reaction center iron-sulfur protein × 1 （Q8KAY1） Cytochrome c × 2 （O07091） PscE × 1 （Q8KDI3） PscF × 1 （Q8KG87） Bacteriochlorophyll a protein × 6 （Q46393） Bacteriochlorophyll A isomer × 2 Chlorophyll A ester × 4 BACTERIOCHLOROPHYLL A × 73 ;[(2R,3S,4S,5R,6R)-6-[(10E,12E,14E)-2,6,10,14,19,23-hexamethyl-25-(2,3,6-trimethylphenyl)pentacosa-6,8,10,12,14,16,18,20,22,24-decaen-2-yl]oxy-3,4,5-tris(oxidanyl)oxan-2-yl]methyl dodecanoate ; × 3 ;2-[(1E,3E,5E,7E,9E,11E,13E,15E,17E,19E)-3,7,12,16,20,24-hexamethylpentacosa-1,3,5,7,9,11,13,15,17,19,23-undecaenyl]-1,3,4-trimethyl-benzene ; × 3 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 10 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 6 IRON/SULFUR CLUSTER × 3 CALCIUM ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSCD_CHLTE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–143； UniProt 1–143

PscE

OrganismNot specified

UniProt Q8KDI3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	Photosystem P840 reaction center, large subunit × 2 （Q8KAY0） Photosystem P840 reaction center iron-sulfur protein × 1 （Q8KAY1） Cytochrome c × 2 （O07091） P840 reaction center 17 kDa protein × 1 （Q8KEP5） PscF × 1 （Q8KG87） Bacteriochlorophyll a protein × 6 （Q46393） Bacteriochlorophyll A isomer × 2 Chlorophyll A ester × 4 BACTERIOCHLOROPHYLL A × 73 ;[(2R,3S,4S,5R,6R)-6-[(10E,12E,14E)-2,6,10,14,19,23-hexamethyl-25-(2,3,6-trimethylphenyl)pentacosa-6,8,10,12,14,16,18,20,22,24-decaen-2-yl]oxy-3,4,5-tris(oxidanyl)oxan-2-yl]methyl dodecanoate ; × 3 ;2-[(1E,3E,5E,7E,9E,11E,13E,15E,17E,19E)-3,7,12,16,20,24-hexamethylpentacosa-1,3,5,7,9,11,13,15,17,19,23-undecaenyl]-1,3,4-trimethyl-benzene ; × 3 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 10 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 6 IRON/SULFUR CLUSTER × 3 CALCIUM ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8KDI3_CHLTE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–59； UniProt 1–59

PscF

OrganismNot specified

UniProt Q8KG87

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	Photosystem P840 reaction center, large subunit × 2 （Q8KAY0） Photosystem P840 reaction center iron-sulfur protein × 1 （Q8KAY1） Cytochrome c × 2 （O07091） P840 reaction center 17 kDa protein × 1 （Q8KEP5） PscE × 1 （Q8KDI3） Bacteriochlorophyll a protein × 6 （Q46393） Bacteriochlorophyll A isomer × 2 Chlorophyll A ester × 4 BACTERIOCHLOROPHYLL A × 73 ;[(2R,3S,4S,5R,6R)-6-[(10E,12E,14E)-2,6,10,14,19,23-hexamethyl-25-(2,3,6-trimethylphenyl)pentacosa-6,8,10,12,14,16,18,20,22,24-decaen-2-yl]oxy-3,4,5-tris(oxidanyl)oxan-2-yl]methyl dodecanoate ; × 3 ;2-[(1E,3E,5E,7E,9E,11E,13E,15E,17E,19E)-3,7,12,16,20,24-hexamethylpentacosa-1,3,5,7,9,11,13,15,17,19,23-undecaenyl]-1,3,4-trimethyl-benzene ; × 3 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 10 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 6 IRON/SULFUR CLUSTER × 3 CALCIUM ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8KG87_CHLTE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–58； UniProt 1–58

Bacteriochlorophyll a protein

OrganismNot specified

UniProt Q46393

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	Photosystem P840 reaction center, large subunit × 2 （Q8KAY0） Photosystem P840 reaction center iron-sulfur protein × 1 （Q8KAY1） Cytochrome c × 2 （O07091） P840 reaction center 17 kDa protein × 1 （Q8KEP5） PscE × 1 （Q8KDI3） PscF × 1 （Q8KG87） Bacteriochlorophyll A isomer × 2 Chlorophyll A ester × 4 BACTERIOCHLOROPHYLL A × 73 ;[(2R,3S,4S,5R,6R)-6-[(10E,12E,14E)-2,6,10,14,19,23-hexamethyl-25-(2,3,6-trimethylphenyl)pentacosa-6,8,10,12,14,16,18,20,22,24-decaen-2-yl]oxy-3,4,5-tris(oxidanyl)oxan-2-yl]methyl dodecanoate ; × 3 ;2-[(1E,3E,5E,7E,9E,11E,13E,15E,17E,19E)-3,7,12,16,20,24-hexamethylpentacosa-1,3,5,7,9,11,13,15,17,19,23-undecaenyl]-1,3,4-trimethyl-benzene ; × 3 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 10 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 6 IRON/SULFUR CLUSTER × 3 CALCIUM ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BCPA_CHLTE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain U； PDBConstruct 1–366； UniProt 1–366 Author chain V； PDBConstruct 1–366； UniProt 1–366 Author chain W； PDBConstruct 1–366； UniProt 1–366 Author chain X； PDBConstruct 1–366； UniProt 1–366 Author chain Y； PDBConstruct 1–366； UniProt 1–366 Author chain Z； PDBConstruct 1–366； UniProt 1–366

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7ueb
Deposition date deposition_date	2022-03-21
Structure title title	Photosynthetic assembly of Chlorobaculum tepidum (RC-FMO2)
Keywords keywords	FMO, reaction center, single-particle cryo-EM, bacteriochlorophyll, photosynthesis, electron transport chain, energy transfer; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7ueb__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7ueb__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7ueb__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	54.92 Å
Rg (electron density)	54.27 Å
Total Rg	54.23 Å
Atom count	37294
Residues	4006
Excluded volume	684670 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7ueb__assembly_1__model_1`	tetradecameric （14）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (16)

Entity 1 Entity 1 polymer

Description description	Photosystem P840 reaction center, large subunit
Molecular weight formula_weight	81784.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,a
Atom count atom_count	37570

MAEQVKPAGVKPKGTVPPPKGNAPAPKANGAPGGASVIKEQDAAKMRRFLFQRTETRSTKWYQIFDTEKLDDEQVVGGHLALLGVLGFIMGIYYISGIQVFPWGAPGFHDNWFYLTIKPRMVSLGIDTYSTKTADLEAAGARLLGWAAFHFLVGSVLIFGGWRHWTHNLTNPFTGRCGNFRDFRFLGKFGDVVFNGTSAKSYKEALGPHAVYMSLLFLGWGIVMWAILGFAPIPDFQTINSETFMSFVFAVIFFALGIYWWNNPPNAAIHLNDDMKAAFSVHLTAIGYINIALGCIAFVAFQQPSFAPYYKELDKLVFYLYGEPFNRVSFNFVEQGGKVISGAKEFADFPAYAILPKSGEAFGMARVVTNLIVFNHIICGVLYVFAGVYHGGQYLLKIQLNGMYNQIKSIWITKGRDQEVQVKILGTVMALCFATMLSVYAVIVWNTICELNIFGTNITMSFYWLKPLPIFQWMFADPSINDWVMAHVITAGSLFSLIALVRIAFFAHTSPLWDDLGLKKNSYSFPCLGPVYGGTCGVSIQDQLWFAMLWGIKGLSAVCWYIDGAWIASMMYGVPAADAKAWDSIAHLHHHYTSGIFYYFWTETVTIFSSSHLSTILMIGHLVWFISFAVWFEDRGSRLEGADIQTRTIRWLGKKFLNRDVNFRFPVLTISDSKLAGTFLYFGGTFMLVFLFLANGFYQTNSPLPPPVSHAAVSGQQMLAQLVDTLMKMIA

Entity 2 Entity 2 polymer

Description description	Photosystem P840 reaction center iron-sulfur protein
Molecular weight formula_weight	23540.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MAEPVENKNQAPAPGAKVPPKGAPAAPKAGAPAAPKGPVAPKAGAPAAKTGASAAKQAGKPRLASLGVTLGRSGVRQESALPYVKPKAVPPPKPAAPAAKGAPAPKGAPAAPAAKAAPGAPVAKAAPKAKKHYFIIENLCVGCGLCLDKCPPKVNAIGYKFYGDVQEGGFRCYIDQAACISCSACFSGDECPSGALIEVLPDGEVLDFSYTPPERLDFDLRFLHRFHREAR

Entity 3 Entity 3 polymer

Description description	Cytochrome c
Molecular weight formula_weight	22741.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,c

MDKNSNGKLIALAVGGAVLMGALFFSVSFLTGYIPAPNHSAILTPLRSFMGWFLLIFCASIIIMGLGKMSSAISDKWFLSFPLSIFVIVMVMFLSLRVYWEKGRTTTVDGKYIRTTAELKEFLNKPAATSDVPPAPAGFDFDAAKKLVDVRCNKCHTLDSVADLFRTKYKKTGQVNLIVKRMQGFPGSGISDDDAKTIGIWLHEKF

Entity 4 Entity 4 polymer

Description description	P840 reaction center 17 kDa protein
Molecular weight formula_weight	16633.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MQPQLSRPQTASNQVRKAVSGPWSGNAVHKAEKYFITSAKRDRDGKLQIELVPASGRRKLSPTPEMIRRLIDGEIEIYILTTQPDIAIDMNKEIIDMENRYVIDFDKRGVKWTMREIPVFYHEGKGLCVELHNKIYTLDQFFK

Entity 5 Entity 5 polymer

Description description	PscE
Molecular weight formula_weight	6690.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MDAKTTILEVLKKEGKPMSAGQIAEKSGLERKEVDKAMKSLKEEELIVSPKRCYWTPKV

Entity 6 Entity 6 polymer

Description description	PscF
Molecular weight formula_weight	6227.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MDIRRLILAFILPPAAVMNKEAGTIMLTGILTLWGWIPGVVAALIMISKEQSGKTAEA

Entity 7 Entity 7 polymer

Description description	Bacteriochlorophyll a protein
Molecular weight formula_weight	40343.4 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U,V,W,X,Y,Z

MALFGSNDVTTAHSDYEIVLEGGSSSWGKVKARAKVNAPPASPLLPADCDVKLNVKPLDPAKGFVRISAVFESIVDSTKNKLTIEADIANETKERRISVGEGMVSVGDFSHTFSFEGSVVNLFYYRSDAVRRNVPNPIYMQGRQFHDILMKVPLDNNDLIDTWEGTVKAIGSTGAFNDWIRDFWFIGPAFTALNEGGQRISRIEVNGLNTESGPKGPVGVSRWRFSHGGSGMVDSISRWAELFPSDKLNRPAQVEAGFRSDSQGIEVKVDGEFPGVSVDAGGGLRRILNHPLIPLVHHGMVGKFNNFNVDAQLKVVLPKGYKIRYAAPQYRSQNLEEYRWSGGAYARWVEHVCKGGVGQFEILYAQ

Entity 8 Entity 8 non-polymer

Description description	Bacteriochlorophyll A isomer
Molecular weight formula_weight	911.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 9 Entity 9 non-polymer

Description description	Chlorophyll A ester
Molecular weight formula_weight	891.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 10 Entity 10 non-polymer

Description description	BACTERIOCHLOROPHYLL A
Molecular weight formula_weight	911.5 kDa
Source method src_method	syn
Copy count entity_count	73

Entity 11 Entity 11 non-polymer

Description description	;[(2R,3S,4S,5R,6R)-6-[(10E,12E,14E)-2,6,10,14,19,23-hexamethyl-25-(2,3,6-trimethylphenyl)pentacosa-6,8,10,12,14,16,18,20,22,24-decaen-2-yl]oxy-3,4,5-tris(oxidanyl)oxan-2-yl]methyl dodecanoate ;
Molecular weight formula_weight	895.3 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 12 Entity 12 non-polymer

Description description	;2-[(1E,3E,5E,7E,9E,11E,13E,15E,17E,19E)-3,7,12,16,20,24-hexamethylpentacosa-1,3,5,7,9,11,13,15,17,19,23-undecaenyl]-1,3,4-trimethyl-benzene ;
Molecular weight formula_weight	532.8 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 13 Entity 13 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 14 Entity 14 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 15 Entity 15 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 16 Entity 16 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.08 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	157486

Photosynthetic assembly of Chlorobaculum tepidum (RC-FMO2)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem P840 reaction center, large subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem P840 reaction center iron-sulfur protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

P840 reaction center 17 kDa protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PscE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PscF

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Bacteriochlorophyll a protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7ueb__assembly_1__model_1

7ueb__assembly_1__model_1 | I(q)

7ueb__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (16)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer