SAXSdb — 7un1

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Sperm acrosome-associated protein 9

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 109	Tubulin beta-4B chain × 38 （P68371） Tubulin alpha-1A chain × 38 （Q71U36） GUANOSINE-5'-DIPHOSPHATE × 38 GUANOSINE-5'-TRIPHOSPHATE × 38 MAGNESIUM ION × 38	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SACA9_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–222； UniProt 1–222 Author chain B； PDBConstruct 1–222； UniProt 1–222 Author chain C； PDBConstruct 1–222； UniProt 1–222 Author chain D； PDBConstruct 1–222； UniProt 1–222 Author chain E； PDBConstruct 1–222； UniProt 1–222 Author chain F； PDBConstruct 1–222； UniProt 1–222 Author chain G； PDBConstruct 1–222； UniProt 1–222 Author chain H； PDBConstruct 1–222； UniProt 1–222 Author chain I； PDBConstruct 1–222； UniProt 1–222 Author chain J； PDBConstruct 1–222； UniProt 1–222 Author chain K； PDBConstruct 1–222； UniProt 1–222 Author chain L； PDBConstruct 1–222； UniProt 1–222 Author chain M； PDBConstruct 1–222； UniProt 1–222 Author chain N； PDBConstruct 1–222； UniProt 1–222 Author chain O； PDBConstruct 1–222； UniProt 1–222 Author chain P； PDBConstruct 1–222； UniProt 1–222 Author chain Q； PDBConstruct 1–222； UniProt 1–222 Author chain R； PDBConstruct 1–222； UniProt 1–222 Author chain S； PDBConstruct 1–222； UniProt 1–222 Author chain T； PDBConstruct 1–222； UniProt 1–222 Author chain U； PDBConstruct 1–222； UniProt 1–222 Author chain V； PDBConstruct 1–222； UniProt 1–222 Author chain W； PDBConstruct 1–222； UniProt 1–222 Author chain X； PDBConstruct 1–222； UniProt 1–222 Author chain d； PDBConstruct 1–222； UniProt 1–222 Author chain e； PDBConstruct 1–222； UniProt 1–222 Author chain f； PDBConstruct 1–222； UniProt 1–222 Author chain g； PDBConstruct 1–222； UniProt 1–222 Author chain h； PDBConstruct 1–222； UniProt 1–222 Author chain i； PDBConstruct 1–222； UniProt 1–222 Author chain j； PDBConstruct 1–222； UniProt 1–222 Author chain k； PDBConstruct 1–222； UniProt 1–222 Author chain l； PDBConstruct 1–222； UniProt 1–222

Tubulin beta-4B chain

OrganismNot specified

UniProt P68371

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 109	Sperm acrosome-associated protein 9 × 33 （Q96E40） Tubulin alpha-1A chain × 38 （Q71U36） GUANOSINE-5'-DIPHOSPHATE × 38 GUANOSINE-5'-TRIPHOSPHATE × 38 MAGNESIUM ION × 38	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBB4B_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain AB； PDBConstruct 1–445； UniProt 1–445 Author chain AD； PDBConstruct 1–445； UniProt 1–445 Author chain AF； PDBConstruct 1–445； UniProt 1–445 Author chain BA； PDBConstruct 1–445； UniProt 1–445 Author chain BD； PDBConstruct 1–445； UniProt 1–445 Author chain BF； PDBConstruct 1–445； UniProt 1–445 Author chain CB； PDBConstruct 1–445； UniProt 1–445 Author chain CD； PDBConstruct 1–445； UniProt 1–445 Author chain CF； PDBConstruct 1–445； UniProt 1–445 Author chain DB； PDBConstruct 1–445； UniProt 1–445 Author chain DD； PDBConstruct 1–445； UniProt 1–445 Author chain DF； PDBConstruct 1–445； UniProt 1–445 Author chain EB； PDBConstruct 1–445； UniProt 1–445 Author chain ED； PDBConstruct 1–445； UniProt 1–445 Author chain EF； PDBConstruct 1–445； UniProt 1–445 Author chain FD； PDBConstruct 1–445； UniProt 1–445 Author chain FF； PDBConstruct 1–445； UniProt 1–445 Author chain FH； PDBConstruct 1–445； UniProt 1–445 Author chain GD； PDBConstruct 1–445； UniProt 1–445 Author chain GF； PDBConstruct 1–445； UniProt 1–445 Author chain GH； PDBConstruct 1–445； UniProt 1–445 Author chain HD； PDBConstruct 1–445； UniProt 1–445 Author chain HF； PDBConstruct 1–445； UniProt 1–445 Author chain HH； PDBConstruct 1–445； UniProt 1–445 Author chain ID； PDBConstruct 1–445； UniProt 1–445 Author chain IF； PDBConstruct 1–445； UniProt 1–445 Author chain IH； PDBConstruct 1–445； UniProt 1–445 Author chain JD； PDBConstruct 1–445； UniProt 1–445 Author chain JF； PDBConstruct 1–445； UniProt 1–445 Author chain KD； PDBConstruct 1–445； UniProt 1–445 Author chain KF； PDBConstruct 1–445； UniProt 1–445 Author chain KH； PDBConstruct 1–445； UniProt 1–445 Author chain LB； PDBConstruct 1–445； UniProt 1–445 Author chain LD； PDBConstruct 1–445； UniProt 1–445 Author chain LF； PDBConstruct 1–445； UniProt 1–445 Author chain MB； PDBConstruct 1–445； UniProt 1–445 Author chain MD； PDBConstruct 1–445； UniProt 1–445 Author chain MF； PDBConstruct 1–445； UniProt 1–445

Tubulin alpha-1A chain

OrganismNot specified

UniProt Q71U36

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 109	Sperm acrosome-associated protein 9 × 33 （Q96E40） Tubulin beta-4B chain × 38 （P68371） GUANOSINE-5'-DIPHOSPHATE × 38 GUANOSINE-5'-TRIPHOSPHATE × 38 MAGNESIUM ION × 38	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBA1A_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain AC； PDBConstruct 1–451； UniProt 1–451 Author chain AE； PDBConstruct 1–451； UniProt 1–451 Author chain BC； PDBConstruct 1–451； UniProt 1–451 Author chain BE； PDBConstruct 1–451； UniProt 1–451 Author chain BG； PDBConstruct 1–451； UniProt 1–451 Author chain CC； PDBConstruct 1–451； UniProt 1–451 Author chain CE； PDBConstruct 1–451； UniProt 1–451 Author chain CG； PDBConstruct 1–451； UniProt 1–451 Author chain DC； PDBConstruct 1–451； UniProt 1–451 Author chain DE； PDBConstruct 1–451； UniProt 1–451 Author chain DG； PDBConstruct 1–451； UniProt 1–451 Author chain EC； PDBConstruct 1–451； UniProt 1–451 Author chain EE； PDBConstruct 1–451； UniProt 1–451 Author chain EG； PDBConstruct 1–451； UniProt 1–451 Author chain FC； PDBConstruct 1–451； UniProt 1–451 Author chain FE； PDBConstruct 1–451； UniProt 1–451 Author chain FG； PDBConstruct 1–451； UniProt 1–451 Author chain GC； PDBConstruct 1–451； UniProt 1–451 Author chain GE； PDBConstruct 1–451； UniProt 1–451 Author chain GG； PDBConstruct 1–451； UniProt 1–451 Author chain HC； PDBConstruct 1–451； UniProt 1–451 Author chain HE； PDBConstruct 1–451； UniProt 1–451 Author chain HG； PDBConstruct 1–451； UniProt 1–451 Author chain IC； PDBConstruct 1–451； UniProt 1–451 Author chain IE； PDBConstruct 1–451； UniProt 1–451 Author chain IG； PDBConstruct 1–451； UniProt 1–451 Author chain JC； PDBConstruct 1–451； UniProt 1–451 Author chain JE； PDBConstruct 1–451； UniProt 1–451 Author chain JG； PDBConstruct 1–451； UniProt 1–451 Author chain KC； PDBConstruct 1–451； UniProt 1–451 Author chain KE； PDBConstruct 1–451； UniProt 1–451 Author chain KG； PDBConstruct 1–451； UniProt 1–451 Author chain LA； PDBConstruct 1–451； UniProt 1–451 Author chain LC； PDBConstruct 1–451； UniProt 1–451 Author chain LE； PDBConstruct 1–451； UniProt 1–451 Author chain MA； PDBConstruct 1–451； UniProt 1–451 Author chain MC； PDBConstruct 1–451； UniProt 1–451 Author chain ME； PDBConstruct 1–451； UniProt 1–451

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7un1
Deposition date deposition_date	2022-04-08
Structure title title	8-nm repeat of the human sperm tip singlet microtubule
Keywords keywords	cilia, microtubule, sperm, cell motility, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7un1__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7un1__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7un1__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	129.20 Å
Total Rg	129.30 Å
Atom count	290845
Residues	37552
Excluded volume	5120100 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7un1__assembly_1__model_1`	109-meric （109）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Sperm acrosome-associated protein 9
Molecular weight formula_weight	25209.0 kDa
Source method src_method	nat
Copy count entity_count	33

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,d,e,f,g,h,i,j,k,l
Atom count atom_count	290845

MNEVKESLRSIEQKYKLFQQQQLTFTAALEHCRENAHDKIRPISSIGQVQSYMEHYCNSSTDRRVLLMFLDICSELNKLCQHFEAVHSGTPVTNNLLEKCKTLVSQSNDLSSLRAKYPHDVVNHLSCDEARNHYGGVVSLIPLILDLMKEWIAHSEKLPRKVLQHVSEPQAHQESTRGAARPAQAIGTQPRATKHKCRQLTKASLKPRGCSKPPWRPPGGKL

Entity 2 Entity 2 polymer

Description description	Tubulin beta-4B chain
Molecular weight formula_weight	49877.8 kDa
Source method src_method	nat
Copy count entity_count	38

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AB,AD,AF,BA,BD,BF,CB,CD,CF,DB,DD,DF,EB,ED,EF,FD,FF,FH,GD,GF,GH,HD,HF,HH,ID,IF,IH,JD,JF,KD,KF,KH,LB,LD,LF,MB,MD,MF

MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEFEEEAEEEVA

Entity 3 Entity 3 polymer

Description description	Tubulin alpha-1A chain
Molecular weight formula_weight	50188.4 kDa
Source method src_method	nat
Copy count entity_count	38

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AC,AE,BC,BE,BG,CC,CE,CG,DC,DE,DG,EC,EE,EG,FC,FE,FG,GC,GE,GG,HC,HE,HG,IC,IE,IG,JC,JE,JG,KC,KE,KG,LA,LC,LE,MA,MC,ME

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY

Entity 4 Entity 4 non-polymer

Description description	GUANOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	443.2 kDa
Source method src_method	syn
Copy count entity_count	38

Entity 5 Entity 5 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	38

Entity 6 Entity 6 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	38

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	6.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	21990

8-nm repeat of the human sperm tip singlet microtubule

1. Protein Identity and Related Structures Protein Identity & Related Structures

Sperm acrosome-associated protein 9

State in the Current Structure

Other States of the Same Protein in the Database

Tubulin beta-4B chain

State in the Current Structure

Other States of the Same Protein in the Database

Tubulin alpha-1A chain

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7un1__assembly_1__model_1

7un1__assembly_1__model_1 | I(q)

7un1__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

7. Citations (1)

8-nm repeat of the human sperm tip singlet microtubule

1. Protein Identity and Related Structures Protein Identity & Related Structures

Sperm acrosome-associated protein 9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tubulin beta-4B chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tubulin alpha-1A chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7un1__assembly_1__model_1

7un1__assembly_1__model_1 | I(q)

7un1__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

7. Citations (1)