7ung

48-nm repeat of the human respiratory doublet microtubule

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein CFAP95

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA95_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 0； PDBConstruct 1–229； UniProt 1–229 Author chain 7； PDBConstruct 1–229； UniProt 1–229

EF-hand domain-containing family member B

OrganismNot specified

UniProt Q8N7U6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EFHB_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 1； PDBConstruct 1–833； UniProt 1–833 Author chain 2； PDBConstruct 1–833； UniProt 1–833

Cilia- and flagella-associated protein 53

OrganismNot specified

UniProt Q96M91

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA53_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 3； PDBConstruct 1–514； UniProt 1–514 Author chain 4； PDBConstruct 1–514； UniProt 1–514

Nucleoside diphosphate kinase 7

OrganismNot specified

UniProt Q9Y5B8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDK7_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 5； PDBConstruct 1–376； UniProt 1–376 Author chain 6； PDBConstruct 1–376； UniProt 1–376

Protein CFAP107

OrganismNot specified

UniProt Q8N1D5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CF107_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 8； PDBConstruct 1–194； UniProt 1–194 Author chain 9； PDBConstruct 1–194； UniProt 1–194

Protein CFAP141

OrganismNot specified

UniProt Q5VU69

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CP141_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain A； PDBConstruct 1–101； UniProt 1–101

Tektin-1

OrganismNot specified

UniProt Q969V4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT1_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain A0； PDBConstruct 1–418； UniProt 1–418 Author chain A1； PDBConstruct 1–418； UniProt 1–418 Author chain A2； PDBConstruct 1–418； UniProt 1–418 Author chain A3； PDBConstruct 1–418； UniProt 1–418 Author chain A4； PDBConstruct 1–418； UniProt 1–418

Tubulin alpha-1A chain

OrganismNot specified

UniProt Q71U36

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBA1A_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain AA； PDBConstruct 1–451； UniProt 1–451 Author chain AC； PDBConstruct 1–451； UniProt 1–451 Author chain AE； PDBConstruct 1–451； UniProt 1–451 Author chain AG； PDBConstruct 1–451； UniProt 1–451 Author chain AI； PDBConstruct 1–451； UniProt 1–451 Author chain AK； PDBConstruct 1–451； UniProt 1–451 Author chain AM； PDBConstruct 1–451； UniProt 1–451 Author chain BA； PDBConstruct 1–451； UniProt 1–451 Author chain BC； PDBConstruct 1–451； UniProt 1–451 Author chain BE； PDBConstruct 1–451； UniProt 1–451 Author chain BG； PDBConstruct 1–451； UniProt 1–451 Author chain BI； PDBConstruct 1–451； UniProt 1–451 Author chain BK； PDBConstruct 1–451； UniProt 1–451 Author chain BM； PDBConstruct 1–451； UniProt 1–451 Author chain CA； PDBConstruct 1–451； UniProt 1–451 Author chain CC； PDBConstruct 1–451； UniProt 1–451 Author chain CE； PDBConstruct 1–451； UniProt 1–451 Author chain CG； PDBConstruct 1–451； UniProt 1–451 Author chain CI； PDBConstruct 1–451； UniProt 1–451 Author chain CK； PDBConstruct 1–451； UniProt 1–451 Author chain CM； PDBConstruct 1–451； UniProt 1–451 Author chain DA； PDBConstruct 1–451； UniProt 1–451 Author chain DC； PDBConstruct 1–451； UniProt 1–451 Author chain DE； PDBConstruct 1–451； UniProt 1–451 Author chain DG； PDBConstruct 1–451； UniProt 1–451 Author chain DI； PDBConstruct 1–451； UniProt 1–451 Author chain DK； PDBConstruct 1–451； UniProt 1–451 Author chain DM； PDBConstruct 1–451； UniProt 1–451 Author chain EC； PDBConstruct 1–451； UniProt 1–451 Author chain EE； PDBConstruct 1–451； UniProt 1–451 Author chain EG； PDBConstruct 1–451； UniProt 1–451 Author chain EI； PDBConstruct 1–451； UniProt 1–451 Author chain EK； PDBConstruct 1–451； UniProt 1–451 Author chain EM； PDBConstruct 1–451； UniProt 1–451 Author chain FC； PDBConstruct 1–451； UniProt 1–451 Author chain FE； PDBConstruct 1–451； UniProt 1–451 Author chain FG； PDBConstruct 1–451； UniProt 1–451 Author chain FI； PDBConstruct 1–451； UniProt 1–451 Author chain FK； PDBConstruct 1–451； UniProt 1–451 Author chain FM； PDBConstruct 1–451； UniProt 1–451 Author chain GC； PDBConstruct 1–451； UniProt 1–451 Author chain GE； PDBConstruct 1–451； UniProt 1–451 Author chain GG； PDBConstruct 1–451； UniProt 1–451 Author chain GI； PDBConstruct 1–451； UniProt 1–451 Author chain GK； PDBConstruct 1–451； UniProt 1–451 Author chain GM； PDBConstruct 1–451； UniProt 1–451 Author chain HC； PDBConstruct 1–451； UniProt 1–451 Author chain HE； PDBConstruct 1–451； UniProt 1–451 Author chain HG； PDBConstruct 1–451； UniProt 1–451 Author chain HI； PDBConstruct 1–451； UniProt 1–451 Author chain HK； PDBConstruct 1–451； UniProt 1–451 Author chain HM； PDBConstruct 1–451； UniProt 1–451 Author chain HO； PDBConstruct 1–451； UniProt 1–451 Author chain IC； PDBConstruct 1–451； UniProt 1–451 Author chain IE； PDBConstruct 1–451； UniProt 1–451 Author chain IG； PDBConstruct 1–451； UniProt 1–451 Author chain II； PDBConstruct 1–451； UniProt 1–451 Author chain IK； PDBConstruct 1–451； UniProt 1–451 Author chain IM； PDBConstruct 1–451； UniProt 1–451 Author chain IO； PDBConstruct 1–451； UniProt 1–451 Author chain JC； PDBConstruct 1–451； UniProt 1–451 Author chain JE； PDBConstruct 1–451； UniProt 1–451 Author chain JG； PDBConstruct 1–451； UniProt 1–451 Author chain JI； PDBConstruct 1–451； UniProt 1–451 Author chain JK； PDBConstruct 1–451； UniProt 1–451 Author chain JM； PDBConstruct 1–451； UniProt 1–451 Author chain KC； PDBConstruct 1–451； UniProt 1–451 Author chain KE； PDBConstruct 1–451； UniProt 1–451 Author chain KG； PDBConstruct 1–451； UniProt 1–451 Author chain KI； PDBConstruct 1–451； UniProt 1–451 Author chain KK； PDBConstruct 1–451； UniProt 1–451 Author chain KM； PDBConstruct 1–451； UniProt 1–451 Author chain KO； PDBConstruct 1–451； UniProt 1–451 Author chain LC； PDBConstruct 1–451； UniProt 1–451 Author chain LE； PDBConstruct 1–451； UniProt 1–451 Author chain LG； PDBConstruct 1–451； UniProt 1–451 Author chain LI； PDBConstruct 1–451； UniProt 1–451 Author chain LK； PDBConstruct 1–451； UniProt 1–451 Author chain LM； PDBConstruct 1–451； UniProt 1–451 Author chain MC； PDBConstruct 1–451； UniProt 1–451 Author chain ME； PDBConstruct 1–451； UniProt 1–451 Author chain MG； PDBConstruct 1–451； UniProt 1–451 Author chain MI； PDBConstruct 1–451； UniProt 1–451 Author chain MK； PDBConstruct 1–451； UniProt 1–451 Author chain MM； PDBConstruct 1–451； UniProt 1–451 Author chain NC； PDBConstruct 1–451； UniProt 1–451 Author chain NE； PDBConstruct 1–451； UniProt 1–451 Author chain NG； PDBConstruct 1–451； UniProt 1–451 Author chain NI； PDBConstruct 1–451； UniProt 1–451 Author chain NK； PDBConstruct 1–451； UniProt 1–451 Author chain NM； PDBConstruct 1–451； UniProt 1–451 Author chain OC； PDBConstruct 1–451； UniProt 1–451 Author chain OE； PDBConstruct 1–451； UniProt 1–451 Author chain OG； PDBConstruct 1–451； UniProt 1–451 Author chain OI； PDBConstruct 1–451； UniProt 1–451 Author chain OK； PDBConstruct 1–451； UniProt 1–451 Author chain OM； PDBConstruct 1–451； UniProt 1–451 Author chain OO； PDBConstruct 1–451； UniProt 1–451 Author chain PC； PDBConstruct 1–451； UniProt 1–451 Author chain PE； PDBConstruct 1–451； UniProt 1–451 Author chain PG； PDBConstruct 1–451； UniProt 1–451 Author chain PI； PDBConstruct 1–451； UniProt 1–451 Author chain PK； PDBConstruct 1–451； UniProt 1–451 Author chain PM； PDBConstruct 1–451； UniProt 1–451 Author chain PO； PDBConstruct 1–451； UniProt 1–451 Author chain QC； PDBConstruct 1–451； UniProt 1–451 Author chain QE； PDBConstruct 1–451； UniProt 1–451 Author chain QG； PDBConstruct 1–451； UniProt 1–451 Author chain QI； PDBConstruct 1–451； UniProt 1–451 Author chain QK； PDBConstruct 1–451； UniProt 1–451 Author chain QM； PDBConstruct 1–451； UniProt 1–451 Author chain QO； PDBConstruct 1–451； UniProt 1–451 Author chain RC； PDBConstruct 1–451； UniProt 1–451 Author chain RE； PDBConstruct 1–451； UniProt 1–451 Author chain RG； PDBConstruct 1–451； UniProt 1–451 Author chain RI； PDBConstruct 1–451； UniProt 1–451 Author chain RK； PDBConstruct 1–451； UniProt 1–451 Author chain RM； PDBConstruct 1–451； UniProt 1–451 Author chain RO； PDBConstruct 1–451； UniProt 1–451 Author chain SE； PDBConstruct 1–451； UniProt 1–451 Author chain SG； PDBConstruct 1–451； UniProt 1–451 Author chain SI； PDBConstruct 1–451； UniProt 1–451 Author chain SK； PDBConstruct 1–451； UniProt 1–451 Author chain SM； PDBConstruct 1–451； UniProt 1–451 Author chain SO； PDBConstruct 1–451； UniProt 1–451 Author chain TE； PDBConstruct 1–451； UniProt 1–451 Author chain TG； PDBConstruct 1–451； UniProt 1–451 Author chain TI； PDBConstruct 1–451； UniProt 1–451 Author chain TK； PDBConstruct 1–451； UniProt 1–451 Author chain TM； PDBConstruct 1–451； UniProt 1–451 Author chain TO； PDBConstruct 1–451； UniProt 1–451 Author chain UE； PDBConstruct 1–451； UniProt 1–451 Author chain UG； PDBConstruct 1–451； UniProt 1–451 Author chain UI； PDBConstruct 1–451； UniProt 1–451 Author chain UK； PDBConstruct 1–451； UniProt 1–451 Author chain UM； PDBConstruct 1–451； UniProt 1–451 Author chain UO； PDBConstruct 1–451； UniProt 1–451 Author chain VE； PDBConstruct 1–451； UniProt 1–451 Author chain VG； PDBConstruct 1–451； UniProt 1–451 Author chain VI； PDBConstruct 1–451； UniProt 1–451 Author chain VK； PDBConstruct 1–451； UniProt 1–451 Author chain VM； PDBConstruct 1–451； UniProt 1–451 Author chain VO； PDBConstruct 1–451； UniProt 1–451 Author chain WE； PDBConstruct 1–451； UniProt 1–451 Author chain WG； PDBConstruct 1–451； UniProt 1–451 Author chain WI； PDBConstruct 1–451； UniProt 1–451 Author chain WK； PDBConstruct 1–451； UniProt 1–451 Author chain WM； PDBConstruct 1–451； UniProt 1–451 Author chain WO； PDBConstruct 1–451； UniProt 1–451

Tubulin beta-4B chain

OrganismNot specified

UniProt P68371

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBB4B_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain AB； PDBConstruct 1–445； UniProt 1–445 Author chain AD； PDBConstruct 1–445； UniProt 1–445 Author chain AF； PDBConstruct 1–445； UniProt 1–445 Author chain AH； PDBConstruct 1–445； UniProt 1–445 Author chain AJ； PDBConstruct 1–445； UniProt 1–445 Author chain AL； PDBConstruct 1–445； UniProt 1–445 Author chain BB； PDBConstruct 1–445； UniProt 1–445 Author chain BD； PDBConstruct 1–445； UniProt 1–445 Author chain BF； PDBConstruct 1–445； UniProt 1–445 Author chain BH； PDBConstruct 1–445； UniProt 1–445 Author chain BJ； PDBConstruct 1–445； UniProt 1–445 Author chain BL； PDBConstruct 1–445； UniProt 1–445 Author chain CB； PDBConstruct 1–445； UniProt 1–445 Author chain CD； PDBConstruct 1–445； UniProt 1–445 Author chain CF； PDBConstruct 1–445； UniProt 1–445 Author chain CH； PDBConstruct 1–445； UniProt 1–445 Author chain CJ； PDBConstruct 1–445； UniProt 1–445 Author chain CL； PDBConstruct 1–445； UniProt 1–445 Author chain DB； PDBConstruct 1–445； UniProt 1–445 Author chain DD； PDBConstruct 1–445； UniProt 1–445 Author chain DF； PDBConstruct 1–445； UniProt 1–445 Author chain DH； PDBConstruct 1–445； UniProt 1–445 Author chain DJ； PDBConstruct 1–445； UniProt 1–445 Author chain DL； PDBConstruct 1–445； UniProt 1–445 Author chain EB； PDBConstruct 1–445； UniProt 1–445 Author chain ED； PDBConstruct 1–445； UniProt 1–445 Author chain EF； PDBConstruct 1–445； UniProt 1–445 Author chain EH； PDBConstruct 1–445； UniProt 1–445 Author chain EJ； PDBConstruct 1–445； UniProt 1–445 Author chain EL； PDBConstruct 1–445； UniProt 1–445 Author chain EN； PDBConstruct 1–445； UniProt 1–445 Author chain FB； PDBConstruct 1–445； UniProt 1–445 Author chain FD； PDBConstruct 1–445； UniProt 1–445 Author chain FF； PDBConstruct 1–445； UniProt 1–445 Author chain FH； PDBConstruct 1–445； UniProt 1–445 Author chain FJ； PDBConstruct 1–445； UniProt 1–445 Author chain FL； PDBConstruct 1–445； UniProt 1–445 Author chain FN； PDBConstruct 1–445； UniProt 1–445 Author chain GB； PDBConstruct 1–445； UniProt 1–445 Author chain GD； PDBConstruct 1–445； UniProt 1–445 Author chain GF； PDBConstruct 1–445； UniProt 1–445 Author chain GH； PDBConstruct 1–445； UniProt 1–445 Author chain GJ； PDBConstruct 1–445； UniProt 1–445 Author chain GL； PDBConstruct 1–445； UniProt 1–445 Author chain GN； PDBConstruct 1–445； UniProt 1–445 Author chain HB； PDBConstruct 1–445； UniProt 1–445 Author chain HD； PDBConstruct 1–445； UniProt 1–445 Author chain HF； PDBConstruct 1–445； UniProt 1–445 Author chain HH； PDBConstruct 1–445； UniProt 1–445 Author chain HJ； PDBConstruct 1–445； UniProt 1–445 Author chain HL； PDBConstruct 1–445； UniProt 1–445 Author chain HN； PDBConstruct 1–445； UniProt 1–445 Author chain IB； PDBConstruct 1–445； UniProt 1–445 Author chain ID； PDBConstruct 1–445； UniProt 1–445 Author chain IF； PDBConstruct 1–445； UniProt 1–445 Author chain IH； PDBConstruct 1–445； UniProt 1–445 Author chain IJ； PDBConstruct 1–445； UniProt 1–445 Author chain IL； PDBConstruct 1–445； UniProt 1–445 Author chain IN； PDBConstruct 1–445； UniProt 1–445 Author chain JB； PDBConstruct 1–445； UniProt 1–445 Author chain JD； PDBConstruct 1–445； UniProt 1–445 Author chain JF； PDBConstruct 1–445； UniProt 1–445 Author chain JH； PDBConstruct 1–445； UniProt 1–445 Author chain JJ； PDBConstruct 1–445； UniProt 1–445 Author chain JL； PDBConstruct 1–445； UniProt 1–445 Author chain JN； PDBConstruct 1–445； UniProt 1–445 Author chain KB； PDBConstruct 1–445； UniProt 1–445 Author chain KD； PDBConstruct 1–445； UniProt 1–445 Author chain KF； PDBConstruct 1–445； UniProt 1–445 Author chain KH； PDBConstruct 1–445； UniProt 1–445 Author chain KJ； PDBConstruct 1–445； UniProt 1–445 Author chain KL； PDBConstruct 1–445； UniProt 1–445 Author chain KN； PDBConstruct 1–445； UniProt 1–445 Author chain LB； PDBConstruct 1–445； UniProt 1–445 Author chain LD； PDBConstruct 1–445； UniProt 1–445 Author chain LF； PDBConstruct 1–445； UniProt 1–445 Author chain LH； PDBConstruct 1–445； UniProt 1–445 Author chain LJ； PDBConstruct 1–445； UniProt 1–445 Author chain LL； PDBConstruct 1–445； UniProt 1–445 Author chain LN； PDBConstruct 1–445； UniProt 1–445 Author chain MB； PDBConstruct 1–445； UniProt 1–445 Author chain MD； PDBConstruct 1–445； UniProt 1–445 Author chain MF； PDBConstruct 1–445； UniProt 1–445 Author chain MH； PDBConstruct 1–445； UniProt 1–445 Author chain MJ； PDBConstruct 1–445； UniProt 1–445 Author chain ML； PDBConstruct 1–445； UniProt 1–445 Author chain MN； PDBConstruct 1–445； UniProt 1–445 Author chain NB； PDBConstruct 1–445； UniProt 1–445 Author chain ND； PDBConstruct 1–445； UniProt 1–445 Author chain NF； PDBConstruct 1–445； UniProt 1–445 Author chain NH； PDBConstruct 1–445； UniProt 1–445 Author chain NJ； PDBConstruct 1–445； UniProt 1–445 Author chain NL； PDBConstruct 1–445； UniProt 1–445 Author chain NN； PDBConstruct 1–445； UniProt 1–445 Author chain OB； PDBConstruct 1–445； UniProt 1–445 Author chain OD； PDBConstruct 1–445； UniProt 1–445 Author chain OF； PDBConstruct 1–445； UniProt 1–445 Author chain OH； PDBConstruct 1–445； UniProt 1–445 Author chain OJ； PDBConstruct 1–445； UniProt 1–445 Author chain OL； PDBConstruct 1–445； UniProt 1–445 Author chain ON； PDBConstruct 1–445； UniProt 1–445 Author chain PD； PDBConstruct 1–445； UniProt 1–445 Author chain PF； PDBConstruct 1–445； UniProt 1–445 Author chain PH； PDBConstruct 1–445； UniProt 1–445 Author chain PJ； PDBConstruct 1–445； UniProt 1–445 Author chain PL； PDBConstruct 1–445； UniProt 1–445 Author chain PN； PDBConstruct 1–445； UniProt 1–445 Author chain QD； PDBConstruct 1–445； UniProt 1–445 Author chain QF； PDBConstruct 1–445； UniProt 1–445 Author chain QH； PDBConstruct 1–445； UniProt 1–445 Author chain QJ； PDBConstruct 1–445； UniProt 1–445 Author chain QL； PDBConstruct 1–445； UniProt 1–445 Author chain QN； PDBConstruct 1–445； UniProt 1–445 Author chain RD； PDBConstruct 1–445； UniProt 1–445 Author chain RF； PDBConstruct 1–445； UniProt 1–445 Author chain RH； PDBConstruct 1–445； UniProt 1–445 Author chain RJ； PDBConstruct 1–445； UniProt 1–445 Author chain RL； PDBConstruct 1–445； UniProt 1–445 Author chain RN； PDBConstruct 1–445； UniProt 1–445 Author chain SD； PDBConstruct 1–445； UniProt 1–445 Author chain SF； PDBConstruct 1–445； UniProt 1–445 Author chain SH； PDBConstruct 1–445； UniProt 1–445 Author chain SJ； PDBConstruct 1–445； UniProt 1–445 Author chain SL； PDBConstruct 1–445； UniProt 1–445 Author chain SN； PDBConstruct 1–445； UniProt 1–445 Author chain TD； PDBConstruct 1–445； UniProt 1–445 Author chain TF； PDBConstruct 1–445； UniProt 1–445 Author chain TH； PDBConstruct 1–445； UniProt 1–445 Author chain TJ； PDBConstruct 1–445； UniProt 1–445 Author chain TL； PDBConstruct 1–445； UniProt 1–445 Author chain TN； PDBConstruct 1–445； UniProt 1–445 Author chain TP； PDBConstruct 1–445； UniProt 1–445 Author chain UD； PDBConstruct 1–445； UniProt 1–445 Author chain UF； PDBConstruct 1–445； UniProt 1–445 Author chain UH； PDBConstruct 1–445； UniProt 1–445 Author chain UJ； PDBConstruct 1–445； UniProt 1–445 Author chain UL； PDBConstruct 1–445； UniProt 1–445 Author chain UN； PDBConstruct 1–445； UniProt 1–445 Author chain UP； PDBConstruct 1–445； UniProt 1–445 Author chain VD； PDBConstruct 1–445； UniProt 1–445 Author chain VF； PDBConstruct 1–445； UniProt 1–445 Author chain VH； PDBConstruct 1–445； UniProt 1–445 Author chain VJ； PDBConstruct 1–445； UniProt 1–445 Author chain VL； PDBConstruct 1–445； UniProt 1–445 Author chain VN； PDBConstruct 1–445； UniProt 1–445 Author chain VP； PDBConstruct 1–445； UniProt 1–445 Author chain WD； PDBConstruct 1–445； UniProt 1–445 Author chain WF； PDBConstruct 1–445； UniProt 1–445 Author chain WH； PDBConstruct 1–445； UniProt 1–445 Author chain WJ； PDBConstruct 1–445； UniProt 1–445 Author chain WL； PDBConstruct 1–445； UniProt 1–445 Author chain WN； PDBConstruct 1–445； UniProt 1–445 Author chain WP； PDBConstruct 1–445； UniProt 1–445

Meiosis-specific nuclear structural protein 1

OrganismNot specified

UniProt Q8NEH6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MNS1_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain B； PDBConstruct 1–495； UniProt 1–495 Author chain C； PDBConstruct 1–495； UniProt 1–495

Tektin-2

OrganismNot specified

UniProt Q9UIF3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT2_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain B0； PDBConstruct 1–430； UniProt 1–430 Author chain B1； PDBConstruct 1–430； UniProt 1–430 Author chain B2； PDBConstruct 1–430； UniProt 1–430 Author chain B3； PDBConstruct 1–430； UniProt 1–430 Author chain B4； PDBConstruct 1–430； UniProt 1–430 Author chain B5； PDBConstruct 1–430； UniProt 1–430 Author chain B6； PDBConstruct 1–430； UniProt 1–430 Author chain B7； PDBConstruct 1–430； UniProt 1–430 Author chain B8； PDBConstruct 1–430； UniProt 1–430 Author chain B9； PDBConstruct 1–430； UniProt 1–430

Tektin-3

OrganismNot specified

UniProt Q9BXF9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT3_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain C0； PDBConstruct 1–490； UniProt 1–490 Author chain C1； PDBConstruct 1–490； UniProt 1–490 Author chain C2； PDBConstruct 1–490； UniProt 1–490 Author chain C3； PDBConstruct 1–490； UniProt 1–490 Author chain C4； PDBConstruct 1–490； UniProt 1–490

Sperm-associated antigen 8

OrganismNot specified

UniProt Q99932

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPAG8_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain D； PDBConstruct 1–485； UniProt 1–485

Tektin-4

OrganismNot specified

UniProt Q8WW24

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT4_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain D0； PDBConstruct 1–435； UniProt 1–435 Author chain D1； PDBConstruct 1–435； UniProt 1–435 Author chain D2； PDBConstruct 1–435； UniProt 1–435 Author chain D3； PDBConstruct 1–435； UniProt 1–435 Author chain D5； PDBConstruct 1–435； UniProt 1–435 Author chain D6； PDBConstruct 1–435； UniProt 1–435 Author chain D7； PDBConstruct 1–435； UniProt 1–435 Author chain D8； PDBConstruct 1–435； UniProt 1–435

Cilia- and flagella-associated protein 161

OrganismNot specified

UniProt Q6P656

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CF161_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain E； PDBConstruct 1–301； UniProt 1–301 Author chain F； PDBConstruct 1–301； UniProt 1–301

Sperm acrosome-associated protein 9

OrganismNot specified

UniProt Q96E40

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SACA9_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain F0； PDBConstruct 1–222； UniProt 1–222 Author chain F1； PDBConstruct 1–222； UniProt 1–222 Author chain F2； PDBConstruct 1–222； UniProt 1–222 Author chain F3； PDBConstruct 1–222； UniProt 1–222 Author chain F4； PDBConstruct 1–222； UniProt 1–222 Author chain F5； PDBConstruct 1–222； UniProt 1–222 Author chain F6； PDBConstruct 1–222； UniProt 1–222 Author chain F7； PDBConstruct 1–222； UniProt 1–222 Author chain F8； PDBConstruct 1–222； UniProt 1–222 Author chain G0； PDBConstruct 1–222； UniProt 1–222 Author chain G1； PDBConstruct 1–222； UniProt 1–222 Author chain G2； PDBConstruct 1–222； UniProt 1–222 Author chain G3； PDBConstruct 1–222； UniProt 1–222 Author chain G4； PDBConstruct 1–222； UniProt 1–222 Author chain G5； PDBConstruct 1–222； UniProt 1–222 Author chain G6； PDBConstruct 1–222； UniProt 1–222 Author chain G7； PDBConstruct 1–222； UniProt 1–222 Author chain G8； PDBConstruct 1–222； UniProt 1–222 Author chain H0； PDBConstruct 1–222； UniProt 1–222 Author chain H1； PDBConstruct 1–222； UniProt 1–222 Author chain H2； PDBConstruct 1–222； UniProt 1–222

Uncharacterized protein C15orf65

OrganismNot specified

UniProt H3BRN8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CO065_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain G； PDBConstruct 1–121； UniProt 1–121

Protein FAM166B

OrganismNot specified

UniProt A8MTA8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F166B_HUMAN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain H； PDBConstruct 1–275； UniProt 1–275 Author chain I； PDBConstruct 1–275； UniProt 1–275 Author chain J； PDBConstruct 1–275； UniProt 1–275 Author chain K； PDBConstruct 1–275； UniProt 1–275 Author chain L； PDBConstruct 1–275； UniProt 1–275 Author chain M； PDBConstruct 1–275； UniProt 1–275 Author chain N； PDBConstruct 1–275； UniProt 1–275

UPF0686 protein C11orf1

OrganismNot specified

UniProt Q9H5F2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CK001_HUMAN
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain I1； PDBConstruct 1–150； UniProt 1–150

Isoform 2 of Cilia- and flagella-associated protein 77

OrganismNot specified

UniProt Q6ZQR2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA77_HUMAN
Isoform	Q6ZQR2-2
PDB entities	20
Chains and sequence ranges	Author chain J1； PDBConstruct 1–284； UniProt 1–284 Author chain J2； PDBConstruct 1–284； UniProt 1–284 Author chain J3； PDBConstruct 1–284； UniProt 1–284 Author chain J4； PDBConstruct 1–284； UniProt 1–284 Author chain J5； PDBConstruct 1–284； UniProt 1–284

Protein FAM183A

OrganismNot specified

UniProt A6NL82

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F183A_HUMAN
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain K1； PDBConstruct 1–134； UniProt 1–134

Uncharacterized protein C5orf49

OrganismNot specified

UniProt A4QMS7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CE049_HUMAN
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain L1； PDBConstruct 1–147； UniProt 1–147 Author chain L2； PDBConstruct 1–147； UniProt 1–147

Protein FAM166C

OrganismNot specified

UniProt A6NJV1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F166C_HUMAN
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain M1； PDBConstruct 1–201； UniProt 1–201 Author chain M2； PDBConstruct 1–201； UniProt 1–201 Author chain M3； PDBConstruct 1–201； UniProt 1–201 Author chain M4； PDBConstruct 1–201； UniProt 1–201

RIB43A-like with coiled-coils protein 2

OrganismNot specified

UniProt Q9H4K1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RIBC2_HUMAN
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain O； PDBConstruct 1–382； UniProt 1–382 Author chain P； PDBConstruct 1–382； UniProt 1–382 Author chain Q； PDBConstruct 1–382； UniProt 1–382 Author chain R； PDBConstruct 1–382； UniProt 1–382 Author chain S； PDBConstruct 1–382； UniProt 1–382

EF-hand domain-containing protein 1

OrganismNot specified

UniProt Q5JVL4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EFHC1_HUMAN
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain T； PDBConstruct 1–640； UniProt 1–640 Author chain U； PDBConstruct 1–640； UniProt 1–640 Author chain V； PDBConstruct 1–640； UniProt 1–640

EF-hand domain-containing family member C2

OrganismNot specified

UniProt Q5JST6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EFHC2_HUMAN
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain W； PDBConstruct 1–749； UniProt 1–749 Author chain X； PDBConstruct 1–749； UniProt 1–749 Author chain Y； PDBConstruct 1–749； UniProt 1–749 Author chain Z； PDBConstruct 1–749； UniProt 1–749

Cilia- and flagella-associated protein 20

OrganismNot specified

UniProt Q9Y6A4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA20_HUMAN
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain XA； PDBConstruct 1–193； UniProt 1–193 Author chain XB； PDBConstruct 1–193； UniProt 1–193 Author chain XC； PDBConstruct 1–193； UniProt 1–193 Author chain XD； PDBConstruct 1–193； UniProt 1–193 Author chain XE； PDBConstruct 1–193； UniProt 1–193 Author chain XF； PDBConstruct 1–193； UniProt 1–193 Author chain XG； PDBConstruct 1–193； UniProt 1–193

Parkin coregulated gene protein

OrganismNot specified

UniProt Q96M98

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PACRG_HUMAN
Isoform	Q96M98-2
PDB entities	28
Chains and sequence ranges	Author chain YB； PDBConstruct 1–257； UniProt 1–257 Author chain YC； PDBConstruct 1–257； UniProt 1–257 Author chain YD； PDBConstruct 1–257； UniProt 1–257 Author chain YE； PDBConstruct 1–257； UniProt 1–257 Author chain YF； PDBConstruct 1–257； UniProt 1–257 Author chain YG； PDBConstruct 1–257； UniProt 1–257

Cilia- and flagella-associated protein 45

OrganismNot specified

UniProt Q9UL16

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA45_HUMAN
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain a； PDBConstruct 1–551； UniProt 1–551 Author chain b； PDBConstruct 1–551； UniProt 1–551 Author chain c； PDBConstruct 1–551； UniProt 1–551 Author chain d； PDBConstruct 1–551； UniProt 1–551

Cilia- and flagella-associated protein 52

OrganismNot specified

UniProt Q8N1V2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA52_HUMAN
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain e； PDBConstruct 1–620； UniProt 1–620 Author chain f； PDBConstruct 1–620； UniProt 1–620 Author chain g； PDBConstruct 1–620； UniProt 1–620

Enkurin

OrganismNot specified

UniProt Q8TC29

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ENKUR_HUMAN
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain h； PDBConstruct 1–256； UniProt 1–256 Author chain i； PDBConstruct 1–256； UniProt 1–256 Author chain j； PDBConstruct 1–256； UniProt 1–256 Author chain k； PDBConstruct 1–256； UniProt 1–256

Protein Flattop

OrganismNot specified

UniProt Q5VTH2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLTOP_HUMAN
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain l； PDBConstruct 1–177； UniProt 1–177 Author chain m； PDBConstruct 1–177； UniProt 1–177 Author chain n； PDBConstruct 1–177； UniProt 1–177

Protein CFAP210

OrganismNot specified

UniProt Q0VFZ6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP276 × 3 （Q5T5A4） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CF210_HUMAN
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain o； PDBConstruct 1–552； UniProt 1–552 Author chain o1； PDBConstruct 1–552； UniProt 1–552 Author chain p； PDBConstruct 1–552； UniProt 1–552

Protein CFAP276

OrganismNot specified

UniProt Q5T5A4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） UPF0691 protein C9orf116 × 2 （Q5BN46） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CF276_HUMAN
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain q； PDBConstruct 1–169； UniProt 1–169 Author chain r； PDBConstruct 1–169； UniProt 1–169 Author chain s； PDBConstruct 1–169； UniProt 1–169

UPF0691 protein C9orf116

OrganismNot specified

UniProt Q5BN46

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 435	Protein CFAP95 × 2 （Q5VTT2） EF-hand domain-containing family member B × 2 （Q8N7U6） Cilia- and flagella-associated protein 53 × 2 （Q96M91） Nucleoside diphosphate kinase 7 × 2 （Q9Y5B8） Protein CFAP107 × 2 （Q8N1D5） Protein CFAP141 × 1 （Q5VU69） Tektin-1 × 5 （Q969V4） Tubulin alpha-1A chain × 149 （Q71U36） Tubulin beta-4B chain × 153 （P68371） Meiosis-specific nuclear structural protein 1 × 2 （Q8NEH6） Tektin-2 × 10 （Q9UIF3） Tektin-3 × 5 （Q9BXF9） Sperm-associated antigen 8 × 1 （Q99932） Tektin-4 × 8 （Q8WW24） Cilia- and flagella-associated protein 161 × 2 （Q6P656） Sperm acrosome-associated protein 9 × 21 （Q96E40） Uncharacterized protein C15orf65 × 1 （H3BRN8） Protein FAM166B × 7 （A8MTA8） UPF0686 protein C11orf1 × 1 （Q9H5F2） Isoform 2 of Cilia- and flagella-associated protein 77 × 5 （Q6ZQR2） Protein FAM183A × 1 （A6NL82） Uncharacterized protein C5orf49 × 2 （A4QMS7） Protein FAM166C × 4 （A6NJV1） RIB43A-like with coiled-coils protein 2 × 5 （Q9H4K1） EF-hand domain-containing protein 1 × 3 （Q5JVL4） EF-hand domain-containing family member C2 × 4 （Q5JST6） Cilia- and flagella-associated protein 20 × 7 （Q9Y6A4） Parkin coregulated gene protein × 6 （Q96M98） Cilia- and flagella-associated protein 45 × 4 （Q9UL16） Cilia- and flagella-associated protein 52 × 3 （Q8N1V2） Enkurin × 4 （Q8TC29） Protein Flattop × 3 （Q5VTH2） Protein CFAP210 × 3 （Q0VFZ6） Protein CFAP276 × 3 （Q5T5A4） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CI116_HUMAN
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain y； PDBConstruct 1–136； UniProt 1–136 Author chain z； PDBConstruct 1–136； UniProt 1–136

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7ung
Deposition date deposition_date	2022-04-11
Structure title title	48-nm repeat of the human respiratory doublet microtubule
Keywords keywords	cilia, microtubule, sperm, cell motility, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7ung__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7ung__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7ung__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	218.40 Å
Total Rg	218.40 Å
Atom count	1265783
Residues	160638
Excluded volume	22337000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7ung__assembly_1__model_1`	435-meric （435）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (38)

Entity 1 Entity 1 polymer

Description description	Protein CFAP95
Molecular weight formula_weight	26483.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0,7
Atom count atom_count	1265783

MDSLDRSCQDWCDRKQHWLEIGPPDLVERKGSLTLRSHHKKYSKPVLVYSWHRDREAFPKGYDIEGPEKVKKLCNSTYRRLGTDESPIWTSETHEKLSQMCLNTEWVEMKSKALLNEETVSSGIIERVTGLPATGFGAVFPRHPPDWSKMCALTTYSEDYVPPYDYQPHAYPCQDDYSIVHRKCRSQFTDLNGSKRFGINTWHDESGIYANSDVKQKLYPLTSGPIVPI

Entity 2 Entity 2 polymer

Description description	EF-hand domain-containing family member B
Molecular weight formula_weight	93940.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,2

MNMEIGHPHEGKDDLGDKRVIMGTKFPMELGIRVGLGKEDSRCGESPVVSNKCEGRMAPPETKFPLSKGLEMGLERQNISRTVMQRGSLGVDSVSASQGTKPSLLPGRMGLENESLLAGYTHERIIQPPLGRVCGSSQAAGSRRAPLASGPEGVEELVGKPAFVMEPRQEMEKESTCVLMKPNTEIKLPVEVDIGLTQAEGPDETKNTEPQMGLVIEPPQCQFAQQHEQRKEAGNIESGVEPPDRIRPIYSGKFFDRTPCWPSAGKVIPVGYRVATCLTEKLPRLITPPEAKKYFNFRYPPAGVERVFYGRANDPQIAPYLTHGIRSKISVLANTLINPQPITTFQQKIKDKKESIYLSNRRAPLGKSHDQAPGLPKGMDTTNTTFGTAVIKEYSAKDVVNPPKSYEEVFKEGNEGHDLYVVSHNDYYAGEAKNRKYNPSSFHRCSVYGVPTPHFNDGRAMAKSLYWLHELQMKRGAKFVSKRADDFKEKFQHKLGRVLDPIAETMNVPPDCTFGACLRPEEYGVGDLIHNRLPDEYLRGKDRQRALIAAVRHHLKKVNYQKFDTLLAAFRHYDKKGDGMIDKDELQEACDQANLSLDDKLLDQLFDYCDVDNDGFINYLEFANFLNWKDKMLLKEYEERVIIKGRKPDCVNPTEANVEEPEQTLLIKPEDIVLKEAGSTEKTLRTLLRPSDKVSNYYKTTSSEINAIVGAIPSTCYPICGVPTIRSDIPAPRIRRISDRTNYGEEGSAYSLLYPTIFARKGVFERDFFKTRSKEEIAEILCNIGVKLSDEEFENVWNLASKKHHRGEVCVENIRNVLDELRHADRIKCKTLM

Entity 3 Entity 3 polymer

Description description	Cilia- and flagella-associated protein 53
Molecular weight formula_weight	61960.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3,4

MYSQRFGTVQREVKGPTPKVVIVRSKPPKGQGAEHHLERIRRSHQKHNAILASIKSSERDRLKAEWDQHNDCKILDSLVRARIKDAVQGFIINIEERRNKLRELLALEENEYFTEMQLKKETIEEKKDRMREKTKLLKEKNEKERQDFVAEKLDQQFRERCEELRVELLSIHQKKVCEERKAQIAFNEELSRQKLVEEQMFSKLWEEDRLAKEKREAQEARRQKELMENTRLGLNAQITSIKAQRQATQLLKEEEARLVESNNAQIKHENEQDMLKKQKAKQETRTILQKALQERIEHIQQEYRDEQDLNMKLVQRALQDLQEEADKKKQKREDMIREQKIYHKYLAQRREEEKAQEKEFDRILEEDKAKKLAEKDKELRLEKEARRQLVDEVMCTRKLQVQEKLQREAKEQEERAMEQKHINESLKELNCEEKENFARRQRLAQEYRKQLQMQIAYQQQSQEAEKEEKRREFEAGVAANKMCLDKVQEVLSTHQVLPQNIHPMRKACPSKLPP

Entity 4 Entity 4 polymer

Description description	Nucleoside diphosphate kinase 7
Molecular weight formula_weight	42545.7 kDa
EC 编号 ec_number	2.7.4.6
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5,6

MNHSERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAISKAGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITTGPIIAMEILRDDAICEWKRLLGPANSGVARTDASESIRALFGTDGIRNAAHGPDSFASAAREMELFFPSSGGCGPANTAKFTNCTCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGVVTEYHDMVTEMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLPEDGLLEVQYFFKILDN

Entity 5 Entity 5 polymer

Description description	Protein CFAP107
Molecular weight formula_weight	23105.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8,9

MFLTAVNPQPLSTPSWQIETKYSTKVLTGNWMEERRKFTRDTDKTPQSIYRKEYIPFPDHRPDQISRWYGKRKVEGLPYKHLITHHQEPPHRYLISTYDDHYNRHGYNPGLPPLRTWNGQKLLWLPEKSDFPLLAPPTNYGLYEQLKQRQLTPKAGLKQSTYTSSYPRPPLCAMSWREHAVPVPPHRLHPFPHF

Entity 6 Entity 6 polymer

Description description	Protein CFAP141
Molecular weight formula_weight	12151.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MSVEKMTKVEESFQKAMGLKKTVDRWRNSHTHCLWQMALGQRRNPYATLRMQDTMVQELALAKKQLLMVRQAALHQLFEKEHQQYQQELNQMGKAFYVERF

Entity 7 Entity 7 polymer

Description description	Tektin-1
Molecular weight formula_weight	48360.1 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A0,A1,A2,A3,A4

MAKLLQPPPKFLPSEWHIANKNQYHRADAQRSRSERLVAESQRLVDEIEKTTRKSQSDVNKKLEQRLEEVQFWKKELDDKLEQLVNVTDDLLIYKIRLEKALETLKEPLHITETCLAYREKRIGIDLVHDTVEHELIKEAEIIQGIMALLTRTLEEASEQIRMNRSAKYNLEKDLKDKFVALTIDDICFSLNNNSPNIRYSENAVRIEPNSVSLEDWLDFSSTNVEKADKQRNNSLMLKALVDRILSQTANDLRKQCDVVDTAFKNGLKDTKDARDKLADHLAKVMEEIASQEKNITALEKAILDQEGPAKVAHTRLETRTHRPNVELCRDVAQYRLMKEVQEITHNVARLKETLAQAQAELKGLHRRQLALQEEIQVKENTIYIDEVLCMQMRKSIPLRDGEDHGVWAGGLRPDAVC

Entity 8 Entity 8 polymer

Description description	Tubulin alpha-1A chain
Molecular weight formula_weight	50188.4 kDa
Source method src_method	nat
Copy count entity_count	149

Polymer Polymer

Polymer type type

polypeptide(L)

Chain IDs strand_id

;AA,AC,AE,AG,AI,AK,AM,BA,BC,BE,BG,BI,BK,BM,CA,CC,CE,CG,CI,CK,CM,DA,DC,DE,DG,DI,DK,DM,EC,EE,EG,EI,EK,EM,FC,FE,FG,FI,FK,FM,GC,GE,GG,GI,GK,GM,HC,HE,HG,HI,HK,HM,HO,IC,IE,IG,II,IK,IM,IO,JC,JE,JG,JI,JK,JM,KC,KE,KG,KI,KK,KM,KO,LC,LE,LG,LI,LK,LM,MC,ME,MG,MI,MK,MM,NC,NE,NG,NI,NK,NM,OC,OE,OG,OI,OK,OM,OO,PC,PE,PG,PI,PK,PM,PO,QC,QE,QG,QI,QK,QM,QO,RC,RE,RG,RI,RK,RM,RO,SE,SG,SI,SK,SM,SO,TE,TG,TI,TK,TM,TO,UE,UG,UI,UK,UM,UO,VE,VG,VI,VK,VM,VO,WE,WG,WI,WK,WM,WO ;

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY

Entity 9 Entity 9 polymer

Description description	Tubulin beta-4B chain
Molecular weight formula_weight	49877.8 kDa
Source method src_method	nat
Copy count entity_count	153

Polymer Polymer

Polymer type type

polypeptide(L)

Chain IDs strand_id

;AB,AD,AF,AH,AJ,AL,BB,BD,BF,BH,BJ,BL,CB,CD,CF,CH,CJ,CL,DB,DD,DF,DH,DJ,DL,EB,ED,EF,EH,EJ,EL,EN,FB,FD,FF,FH,FJ,FL,FN,GB,GD,GF,GH,GJ,GL,GN,HB,HD,HF,HH,HJ,HL,HN,IB,ID,IF,IH,IJ,IL,IN,JB,JD,JF,JH,JJ,JL,JN,KB,KD,KF,KH,KJ,KL,KN,LB,LD,LF,LH,LJ,LL,LN,MB,MD,MF,MH,MJ,ML,MN,NB,ND,NF,NH,NJ,NL,NN,OB,OD,OF,OH,OJ,OL,ON,PD,PF,PH,PJ,PL,PN,QD,QF,QH,QJ,QL,QN,RD,RF,RH,RJ,RL,RN,SD,SF,SH,SJ,SL,SN,TD,TF,TH,TJ,TL,TN,TP,UD,UF,UH,UJ,UL,UN,UP,VD,VF,VH,VJ,VL,VN,VP,WD,WF,WH,WJ,WL,WN,WP ;

MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEFEEEAEEEVA

Entity 10 Entity 10 polymer

Description description	Meiosis-specific nuclear structural protein 1
Molecular weight formula_weight	60687.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,C

MGSKRRNLSCSERHQKLVDENYCKKLHVQALKNVNSQIRNQMVQNENDNRVQRKQFLRLLQNEQFELDMEEAIQKAEENKRLKELQLKQEEKLAMELAKLKHESLKDEKMRQQVRENSIELRELEKKLKAAYMNKERAAQIAEKDAIKYEQMKRDAEIAKTMMEEHKRIIKEENAAEDKRNKAKAQYYLDLEKQLEEQEKKKQEAYEQLLKEKLMIDEIVRKIYEEDQLEKQQKLEKMNAMRRYIEEFQKEQALWRKKKREEMEEENRKIIEFANMQQQREEDRMAKVQENEEKRLQLQNALTQKLEEMLRQREDLEQVRQELYQEEQAEIYKSKLKEEAEKKLRKQKEMKQDFEEQMALKELVLQAAKEEEENFRKTMLAKFAEDDRIELMNAQKQRMKQLEHRRAVEKLIEERRQQFLADKQRELEEWQLQQRRQGFINAIIEEERLKLLKEHATNLLGYLPKGVFKKEDDIDLLGEEFRKVYQQRSEICEEK

Entity 11 Entity 11 polymer

Description description	Tektin-2
Molecular weight formula_weight	49743.2 kDa
Source method src_method	nat
Copy count entity_count	10

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B0,B1,B2,B3,B4,B5,B6,B7,B8,B9

MATLSVKPSRRFQLPDWHTNSYLLSTNAQLQRDASHQIRQEARVLRNETNNQTIWDEHDNRTRLVERIDTVNRWKEMLDKCLTDLDAEIDALTQMKESAEQNLQAKNLPLDVAIECLTLRESRRDIDVVKDPVEDELHKEVEVIEATKKALQQKVSQAFEQLCLLQEVQQQLNSDHRGKMETLEIDRGCLSLNLRSPNISLKVDPTRVPDGSTTLQQWDDFSRFNKDRAEAEMKAATELREATALTIAETNNELEAQRVATEFAFRKRLREMEKVYSELKWQEKNTLEEIAELQEDIRHLEEDLRTKLLSLKLSHTRLEARTYRPNVELCRDQAQYGLTDEVHQLEATIAALKQKLAQAQDALDALCKHLARLQADIACKANSMLLDTKCMDTRRKLTVPAERFVPEVDTFTRTTNSTLSPLKSCQLELA

Entity 12 Entity 12 polymer

Description description	Tektin-3
Molecular weight formula_weight	56717.9 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C0,C1,C2,C3,C4

MERVGCTLTTTYAHPRPTPTNFLPAISTMASSYRDRFPHSNLTHSLSLPWRPSTYYKVASNSPSVAPYCTRSQRVSENTMLPFVSNRTTFFTRYTPDDWYRSNLTNYQESNTSRHNSEKLRVDTSRLIQDKYQQTRKTQADTTQNLGERVNDIGFWKSEIIHELDEMIGETNALTDVKKRLERALMETEAPLQVARECLFHREKRMGIDLVHDEVEAQLLTEVDTILCCQERMKLHLDKAIAQLAANRASQHELEKDLSDKQTAYRIDDKCHHLRNTSDGVGYFRGVERVDATVSVPESWAKFTDDNILRSQSERAASAKLRDDIENLLVVTANEMWNQFNKVNLSFTNRIAETADAKNKIQTHLAKTLQEIFQTEMTIESIKKAIKDKTAFLKVAQTRLDERTRRPNIELCRDMAQLRLVNEVHEVDDTIQTLQQRLRDAEDTLQSLVHIKATLEYDLAVKANSLYIDQEKCMSMRKSYPNTLRLVGFC

Entity 13 Entity 13 polymer

Description description	Sperm-associated antigen 8
Molecular weight formula_weight	51187.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

METNESTEGSRSRSRSLDIQPSSEGLGPTSEPFPSSDDSPRSALAAATAAAAAAASAAAATAAFTTAKAAALSTKTPAPCSEFMEPSSDPSLLGEPCAGPGFTHNIAHGSLGFEPVYVSCIAQDTCTTTDHSSNPGPVPGSSSGPVLGSSSGAGHGSGSGSGPGCGSVPGSGSGPGPGSGPGSGPGHGSGSHPGPASGPGPDTGPDSELSPCIPPGFRNLVADRVPNYTSWSQHCPWEPQKQPPWEFLQVLEPGARGLWKPPDIKGKLMVCYETLPRGQCLLYNWEEERATNHLDQVPSMQDGSESFFFRHGHRGLLTMQLKSPMPSSTTQKDSYQPPGNVYWPLRGKREAMLEMLLQHQICKEVQAEQEPTRKLFEVESVTHHDYRMELAQAGTPAPTKPHDYRQEQPETFWIQRAPQLPGVSNIRTLDTPFRKNCSFSTPVPLSLGKLLPYEPENYPYQLGEISSLPCPGGRLGGGGGRMTPF

Entity 14 Entity 14 polymer

Description description	Tektin-4
Molecular weight formula_weight	50725.9 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D0,D1,D2,D3,D5,D6,D7,D8

MAQTVPPCELPCKEYDVARNTGAYTSSGLATASFRTSKYLLEEWFQNCYARYHQAFADRDQSERQRHESQQLATETQALAQRTQQDSTRTVGERLQDTHSWKSELQREMEALAAETNLLLAQKQRLERALDATEVPFSITTDNLQCRERREHPNLVRDHVETELLKEAELIRNIQELLKRTIMQAVSQIRLNREHKETCEMDWSDKMEAYNIDETCGRHHSQSTEVQAHPYSTTFQESASTPETRAKFTQDNLCRAQRERLASANLRVLVDCILRDTSEDLRLQCDAVNLAFGRRCEELEDARYKLHHHLHKTLREITDQEHNVAALKQAIKDKEAPLHVAQTRLYLRSHRPNMELCRDAAQFRLLSEVEELNMSLTALREKLLEAEQSLRNLEDIHMSLEKDIAAMTNSLFIDRQKCMAHRTRYPTILQLAGYQ

Entity 15 Entity 15 polymer

Description description	Cilia- and flagella-associated protein 161
Molecular weight formula_weight	34340.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F

MAQNVYGPGVRIGNWNEDVYLEEELMKDFLEKRDKGKLLIQRSRRLKQNLLRPMQLSVTEDGYIHYGDKVMLVNPDDPDTEADVFLRGDLSLCMTPDEIQSHLKDELEVPCGLSAVQAKTPIGRNTFIILSVHRDATGQVLRYGQDFCLGITGGFDNKMLYLSSDHRTLLKSSKRSWLQEVYLTDEVSHVNCWQAAFPDPQLRLEYEGFPVPANAKILINHCHTNRGLAAHRHLFLSTYFGKEAEVVAHTYLDSHRVEKPRNHWMLVTGNPRDASSSMLDLPKPPTEDTRAMEQAMGLDTQ

Entity 16 Entity 16 polymer

Description description	Sperm acrosome-associated protein 9
Molecular weight formula_weight	25209.0 kDa
Source method src_method	nat
Copy count entity_count	21

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F0,F1,F2,F3,F4,F5,F6,F7,F8,G0,G1,G2,G3,G4,G5,G6,G7,G8,H0,H1,H2

MNEVKESLRSIEQKYKLFQQQQLTFTAALEHCRENAHDKIRPISSIGQVQSYMEHYCNSSTDRRVLLMFLDICSELNKLCQHFEAVHSGTPVTNNLLEKCKTLVSQSNDLSSLRAKYPHDVVNHLSCDEARNHYGGVVSLIPLILDLMKEWIAHSEKLPRKVLQHVSEPQAHQESTRGAARPAQAIGTQPRATKHKCRQLTKASLKPRGCSKPPWRPPGGKL

Entity 17 Entity 17 polymer

Description description	Uncharacterized protein C15orf65
Molecular weight formula_weight	13778.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MTDRNRDKKSTSPSNSDTEMKSEQLPPCVNPGNPVFSCMLDPKTLQTATSLSKPQMIMYKTNSSHYGEFLPIPQFFPCNYTPKEQVFSSHIRATGFYQNNTLNTAPDRTRTLDFPNIQHTL

Entity 18 Entity 18 polymer

Description description	Protein FAM166B
Molecular weight formula_weight	30610.6 kDa
Source method src_method	nat
Copy count entity_count	7

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,I,J,K,L,M,N

MAVASTFIPGLNPQNPHYIPGYTGHCPLLRFSVGQTYGQVTGQLLRGPPGLAWPPVHRTLLPPIRPPRSPEVPRESLPVRRGQERLSSSMIPGYTGFVPRAQFIFAKNCSQVWAEALSDFTHLHEKQGSEELPKEAKGRKDTEKDQVPEPEGQLEEPTLEVVEQASPYSMDDRDPRKFFMSGFTGYVPCARFLFGSSFPVLTNQALQEFGQKHSPGSAQDPKHLPPLPRTYPQNLGLLPNYGGYVPGYKFQFGHTFGHLTHDALGLSTFQKQLLA

Entity 19 Entity 19 polymer

Description description	UPF0686 protein C11orf1
Molecular weight formula_weight	17806.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I1

MAASQCLCCSKFLFQRQNLACFLTNPHCGSLVNADGHGEVWTDWNNMSKFFQYGWRCTTNENTYSNRTLMGNWNQERYDLRNIVQPKPLPSQFGHYFETTYDTSYNNKMPLSTHRFKREPHWFPGHQPELDPPRYKCTEKSTYMNSYSKP

Entity 20 Entity 20 polymer

Description description	Isoform 2 of Cilia- and flagella-associated protein 77
Molecular weight formula_weight	33037.2 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J1,J2,J3,J4,J5

MPEARSSGPDLTRWRKQQQPVRRTVSQVCPPPRRPLTVADIRSGMENERLGVVRDSMFQNPLIVKAELGKPRERSYSLPGINFNYGLYIRGLDGGVPEAIGRWNVFKQQPTCPHELTRNYIAMNRGAVKAGLVTARENLLYRQLNDIRISDQDDRRMKKEPPPLPPNMTFGIRARPSTPFFDLLQHRYLQLWVQEQKATQKAIKLEKKQKVVLGKLYETRSSQLRKYKPPVKLDTLWHMPHFQKVGRHLDTFPTEADRQRALKAHREECAVRQGTLRMGNYTHP

Entity 21 Entity 21 polymer

Description description	Protein FAM183A
Molecular weight formula_weight	16028.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K1

MAGHPKEKVIPDEVHQNQILRELYLKELRTQKLYTQYHVNPLRKIHTVTRKPMSWHDNLEEPADARFLNLIHHAAQGPRKKYPETQTENQEVGWDLEPLINPERHDRRLNHFRVCSDITLYKAKTWGLGDDHHK

Entity 22 Entity 22 polymer

Description description	Uncharacterized protein C5orf49
Molecular weight formula_weight	17020.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L1,L2

MEDDEEETTASTLRGKPRPPPVSAQSAFSYIPPRRLDPKEHSYYYRPARTGIISLYDCIFKRRLDYDQKLHRDDREHAKSLGLHVNEEEQERPVGVLTSSVYGKRINQPIEPLNRDFGRANHVQADFYRKNDIPSLKEPGFGHIAPS

Entity 23 Entity 23 polymer

Description description	Protein FAM166C
Molecular weight formula_weight	23457.8 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M1,M2,M3,M4

MASRSAGTLLTEFNAAYVPPGLMPGYQGHVPTVAFSFGAPYGTTTLKYFQDHRNRAMEKSHTPFSQGGHFPTIFSTNPNLLLMERASTRDRWLHKPSYTRFNLDSHRSTELTNFYQMVQQHRKYYQDKTGTVPRVPYFAMPVREPERYPLPTVLPPLCPKKKWHLLRLAPENLKTYQTFPSGKRVSPQERKKRDCYFEFRA

Entity 24 Entity 24 polymer

Description description	RIB43A-like with coiled-coils protein 2
Molecular weight formula_weight	45510.2 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,P,Q,R,S

MGSQTMAVALPRDLRQDANLAKRRHAELCRQKRVFNARNRIIGGDTEAWDVQVHDQKIKEATEKARHETFAAEMRQNDKIMCILENRKKRDRKNLCRAINDFQQSFQKPETRREFDLSDPLALKKDLPARQSDNDVRNTISGMQKFMGEDLNFHERKKFQEEQNREWSLQQQREWKNARAEQKCAEALYTETRLQFDETAKHLQKLESTTRKAVCASVKDFNKSQAIESVERKKQEKKQEQEDNLAEITNLLRGDLLSENPQQAASSFGPHRVVPDRWKGMTQEQLEQIRLVQKQQIQEKLRLQEEKRQRDLDWDRRRIQGARATLLFERQQWRRQRDLRRALDSSNLSLAKEQHLQKKYMNEVYTNQPTGDYFTQFNTGSR

Entity 25 Entity 25 polymer

Description description	EF-hand domain-containing protein 1
Molecular weight formula_weight	74084.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T,U,V

MVSNPVHGLPFLPGTSFKDSTKTAFHRSQTLSYRNGYAIVRRPTVGIGGDRLQFNQLSQAELDELASKAPVLTYGQPKQAPPADFIPAHVAFDKKVLKFDAYFQEDVPMSTEEQYRIRQVNIYYYLEDDSMSVIEPVVENSGILQGKLIKRQRLAKNDRGDHYHWKDLNRGINITIYGKTFRVVDCDQFTQVFLESQGIELNPPEKMALDPYTELRKQPLRKYVTPSDFDQLKQFLTFDKQVLRFYAIWDDTDSMYGECRTYIIHYYLMDDTVEIREVHERNDGRDPFPLLMNRQRVPKVLVENAKNFPQCVLEISDQEVLEWYTAKDFIVGKSLTILGRTFFIYDCDPFTRRYYKEKFGITDLPRIDVSKREPPPVKQELPPYNGFGLVEDSAQNCFALIPKAPKKDVIKMLVNDNKVLRYLAVLESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKYLGRTKVVKPYSTVDNPVYYGPSDFFIGAVIEVFGHRFIILDTDEYVLKYMESNAAQYSPEALASIQNHVRKREAPAPEAESKQTEKDPGVQELEALIDTIQKQLKDHSCKDNIREAFQIYDKEASGYVDRDMFFKICESLNVPVDDSLVKELIRMCSHGEGKINYYNFVRAFSN

Entity 26 Entity 26 polymer

Description description	EF-hand domain-containing family member C2
Molecular weight formula_weight	87516.8 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W,X,Y,Z

MALPLLPGNSFNRNVGKEKFHKSQHWGFCNNVMMLVSDEKPGIGGEPLLGQKIKPKCSIYPKGDGSDVPSWVAFDKQVLSFDAYLEEEVLDKSQTNYRIRYYKIYFYPEDDTIQVNEPEVKNSGLLQGTSIRRHRITLPPPDEDQFYTVYHFNVGTEVVFYGRTFKIYDCDAFTRNFLRKIGVKVNPPVQCPEDPYMKIRREVVEHVEPLRPYESLDTLKQFLQYHGKILCFFCLWDDSVSMFGDRRELILHYFLCDDTIEIKELLPHSSGRDALKMFLRRSKLPKNCPPRVYQPGQITDRAVLNSYGDFIKNQADGYLFDRYKLGKVDQEFYKDSDLSLGVTINVWGRKVLLYDCDEFTKSYYKSKYGIENFTSVSCKPPSPPPKIERKFPPYNGFGSEEDSLRNCIDLKPTPHRRNFKKFMEKDSYGSKSNILRFFAKLVTDKCVDLDRMFVISYYLGDDTISVFEPIERNSGIAGGMFLKRSRVKKPGQEVFKSELSEYIKAEELYIGVTVNVNGYLFRLLNADEYTLNYMEQNTDKYPFSNLKLALQKLKQEEGKSRELKQVFKAADSKHTNMVDYNTFRDILMSLTVGNLAEQEFVTIARHYRVPEGTCSDMDFLIALAHEKFKKNMFENFDTFIYSCVYEDREKKNVLPTKDIKRLCKSSRLPLSDDLLESLLSRFEDSEKQIDYKSFFSALNWRKNPVPELQPASYLKERCEDVWLGMPSPIPAKYIDYWTFLKDAFGLEEE

Entity 27 Entity 27 polymer

Description description	Cilia- and flagella-associated protein 20
Molecular weight formula_weight	22807.5 kDa
Source method src_method	nat
Copy count entity_count	7

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	XA,XB,XC,XD,XE,XF,XG

MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ

Entity 28 Entity 28 polymer

Description description	Parkin coregulated gene protein
Molecular weight formula_weight	29352.2 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	YB,YC,YD,YE,YF,YG

MVAEKETLSLNKCPDKMPKRTKLLAQQPLPVHQPHSLVSEGFTVKAMMKNSVVRGPPAAGAFKERPTKPTAFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLCEMTFPYEFFARQGIHDMLEHGGNKILPVLPQLIIPIKNALNLRNRQVICVTLKVLQHLVVSAEMVGKALVPYYRQILPVLNIFKNMNVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGENAFINIKYVVPTYESCLLN

Entity 29 Entity 29 polymer

Description description	Cilia- and flagella-associated protein 45
Molecular weight formula_weight	65858.1 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,b,c,d

MPLSTAGILSSSSAASNRSRNKARYRTKAVSSEVDESLFGDIKSPAQGQSDSPIVLLRDKHTLQKTLTALGLDRKPETIQLITRDMVRELIVPTEDPSGESLIISPEEFERIKWASHVLTREELEARDQAFKKEKEATMDAVMTRKKIMKQKEMVWNNNKKLSDLEEVAKERAQNLLQRANKLRMEQEEELKDMSKIILNAKCHAIRDAQILEKQQIQKELDTEEKRLDQMMEVERQKSIQRQEELERKRREERIRGRRQIVEQMEKNQEERSLLAEQREQEKEQMLEYMEQLQEEDLKDMERRQQQKLKMQAEIKRINDENQKQKAELLAQEKLADQMVMEFTKKKMAREAEFEAEQERIRREKEKEIARLRAMQEKAQDYQAEQDALRAKRNQEVADREWRRKEKENARKKMETEAELRKSRLEQVAFKEHALAVQVQRDRDEFERILRAQREQIEKERLEEEKKATGRLQHANELRRQVRENQQKEVQNRIATFEEGRRLKEEAQKRRERIDEIKRKKLEELRATGLPEKYCIEAERKANILPATSVN

Entity 30 Entity 30 polymer

Description description	Cilia- and flagella-associated protein 52
Molecular weight formula_weight	68379.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e,f,g

MDNKISPEAQVAELELDAVIGFNGHVPTGLKCHPDQEHMIYPLGCTVLIQAINTKEQNFLQGHGNNVSCLAISRSGEYIASGQVTFMGFKADIILWDYKNRELLARLSLHKGKIEALAFSPNDLYLVSLGGPDDGSVVVWSIAKRDAICGSPAAGLNVGNATNVIFSRCRDEMFMTAGNGTIRVWELDLPNRKIWPTECQTGQLKRIVMSIGVDDDDSFFYLGTTTGDILKMNPRTKLLTDVGPAKDKFSLGVSAIRCLKMGGLLVGSGAGLLVFCKSPGYKPIKKIQLQGGITSITLRGEGHQFLVGTEESHIYRVSFTDFKETLIATCHFDAVEDIVFPFGTAELFATCAKKDIRVWHTSSNRELLRITVPNMTCHGIDFMRDGKSIISAWNDGKIRAFAPETGRLMYVINNAHRIGVTAIATTSDCKRVISGGGEGEVRVWQIGCQTQKLEEALKEHKSSVSCIRVKRNNEECVTASTDGTCIIWDLVRLRRNQMILANTLFQCVCYHPEEFQIITSGTDRKIAYWEVFDGTVIRELEGSLSGSINGMDITQEGVHFVTGGNDHLVKVWDYNEGEVTHVGVGHSGNITRIRISPGNQYIVSVSADGAILRWKYPYTS

Entity 31 Entity 31 polymer

Description description	Enkurin
Molecular weight formula_weight	29510.3 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h,i,j,k

MDPTCSSECIYNLIPSDLKEPPQPPRYISIFKATVKDDMQKAKTAMKTMGPAKVEVPSPKDFLKKHSKEKTLPPKKNFDRNVPKKPAVPLKTDHPVMGIQSGKNFINTNAADIIMGVAKKPKPIYVDKRTGDKHDLEPSGLVPKYINKKDYGVTPEYICKRNEEIKKAQEDYDRYIQENLKKAAMKRLSDEEREAVLQGLKKNWEEVHKEFQSLSVFIDSIPKKIRKQRLEEEMKQLEHDIGIIEKHKIIYIANNA

Entity 32 Entity 32 polymer

Description description	Protein Flattop
Molecular weight formula_weight	19320.9 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l,m,n

MATNYSANQYEKAFSSKYLQNWSPTKPTKESISSHEGYTQIIANDRGHLLPSVPRSKANPWGSFMGTWQMPLKIPPARVTLTSRTTAGAASLTKWIQKNPDLLKASNGLCPEILGKPHDPDSQKKLRKKSITKTVQQARSPTIIPSSPAANLNSPDELQSSHPSAGHTPGPQRPAKS

Entity 33 Entity 33 polymer

Description description	Protein CFAP210
Molecular weight formula_weight	66544.0 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o,o1,p

MDTSSEMLVRFGRRCGRAKESTEIRNSEEDQVLYLPLLPSKVDLQQVTIIPHDEWKRIQDSLDRLTREAACLRAERKAKKEMHLRSQEVVKHWTNTYAGMKEQKLEAKKKRDEEIEAERQILDLEEEIYKQGKRKKAIENAKQYQFYQTERVKNFHSGLLLSRVMKERDAQIEFRKSKIKSDKKWEEQLKLNIEKAFKEEQEKAEKRHRERVALAKDHLKQIKEHEEEEERRKKYEEKDAEEIKRQNALYEIEMRKKLEKKREEMHESRRRFLEHMQDKHIIKAVEQQQQEEEDEKMRKFIKAKKRLIQMGKEKEAETHRLMEKRRERIHNFLSELLKEKLDNEDMIIARDIAEAEAEWEKREREKDEKNKAELKTIAEYRAIVMKNKEEEERQRKIEAKEQLLAVMKADQIFWEHEKEKKCKADKEHQEVQDAHIQQMAKNKFNAKQAKQAELDYCRLTEALVAEKEKEFQDYAREVIELESETTNKYIYPLVKAVQEGPGGGRGPVFVDRGGLRPSYQANDVTGVQLPFYNSQGPKYNFQKSKRRLGFTW

Entity 34 Entity 34 polymer

Description description	Protein CFAP276
Molecular weight formula_weight	19376.7 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q,r,s

MPPTRDPFQQPTLDNDDSYLGELRASKKLPYKNPTHLAQQQEPWSRLNSTPTITSMRRDAYYFDPEIPKDDLDFRLAALYNHHTGTFKNKSEILLNQKTTQDTYRTKIQFPGEFLTPPTPPITFLANIRHWINPKKESIHSIQGSIVSPHTAATNGGYSRKKDGGFFST

Entity 35 Entity 35 polymer

Description description	UPF0691 protein C9orf116
Molecular weight formula_weight	15278.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	y,z

MAEECPRACAEPVAPKATAPPERTSDYYRVSADLPGRFNNPGWFRGYRTQKAVSVYRTSNQAYGSRAPTVHEMPKVFYPNSNKFSQQLAAGGMFRNNTLNVYLEKSIVTGPDNCITSCDRLNFHPSYNINRPSICD

Entity 36 Entity 36 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	149

Entity 37 Entity 37 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	149

Entity 38 Entity 38 non-polymer

Description description	GUANOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	443.2 kDa
Source method src_method	syn
Copy count entity_count	153

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	208558

48-nm repeat of the human respiratory doublet microtubule

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein CFAP95

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

EF-hand domain-containing family member B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cilia- and flagella-associated protein 53

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Nucleoside diphosphate kinase 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein CFAP107

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein CFAP141

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tektin-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tubulin alpha-1A chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tubulin beta-4B chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Meiosis-specific nuclear structural protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer