SAXSdb — 7vyt

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

T-cell immunoreceptor with Ig and ITIM domains

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain A； UniProt 23–129	Not recorded	MG1131 heavy chain variable region × 1 MG1131 light chain variable region × 1 FLC CITRATE ANION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293.15 K；200mM ammonium citrate, 20% (v/v) polyethylene glycol 3350	Resolution 1.53 Å R-free 0.219
2	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain T； UniProt 23–129	Not recorded	MG1131 heavy chain variable region × 1 MG1131 light chain variable region × 1 FLC CITRATE ANION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293.15 K；200mM ammonium citrate, 20% (v/v) polyethylene glycol 3350	Resolution 1.53 Å R-free 0.219

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7VYT	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3Q0H Structure of T-cell immunoreceptor with immunoglobulin and ITIM domains (TIGIT) Deposited 2010-12-15	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 22–137（116 aa） Fragment：Ig-like V-type domain residues 22-137	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；1.3M Ammonium Sulfate, 0.1M MES pH 6.0, Vapor diffusion, Sitting drop, temperature 298K	Resolution 1.70 Å R-free 0.237
3Q0H Structure of T-cell immunoreceptor with immunoglobulin and ITIM domains (TIGIT) Deposited 2010-12-15	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 22–137（116 aa） Fragment：Ig-like V-type domain residues 22-137	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；1.3M Ammonium Sulfate, 0.1M MES pH 6.0, Vapor diffusion, Sitting drop, temperature 298K	Resolution 1.70 Å R-free 0.237
3RQ3 Structure of T-cell immunoreceptor with immunoglobulin and ITIM domains (TIGIT) in hexagonal crystal form Deposited 2011-04-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 22–137（116 aa） Fragment：UNP residues 22-137 Chain B 22–137（116 aa） Fragment：UNP residues 22-137	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；1.0M Ammonium Sulfate, 0.1M BIS-TRIS pH 5.5, 1% PEG3350, Vapor diffusion, Sitting drop, temperature 298K	Resolution 2.70 Å R-free 0.253
3UCR Crystal structure of the immunoreceptor TIGIT IgV domain Deposited 2011-10-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 23–128（106 aa） Fragment：UNP residues 23-128 Chain C 23–128（106 aa） Fragment：UNP residues 23-128	Not recorded	CL CHLORIDE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；1.5 M (NH4)2SO4 and 0.1M HEPES pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.63 Å R-free 0.274
3UCR Crystal structure of the immunoreceptor TIGIT IgV domain Deposited 2011-10-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 23–128（106 aa） Fragment：UNP residues 23-128 Chain D 23–128（106 aa） Fragment：UNP residues 23-128	Not recorded	CL CHLORIDE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；1.5 M (NH4)2SO4 and 0.1M HEPES pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.63 Å R-free 0.274
3UDW Crystal structure of the immunoreceptor TIGIT in complex with Poliovirus receptor (PVR/CD155/necl-5) D1 domain Deposited 2011-10-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 20–128（109 aa） Fragment：TIGIT, UNP residues 20-128 Chain B 20–128（109 aa） Fragment：TIGIT, UNP residues 20-128	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；298 K；0.1 M Ammonium acetate 0.1 M Bis-Tris pH 5.5 17% PEG 10000, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.90 Å R-free 0.287
5V52 Structure of TIGIT bound to nectin-2 (CD112) Deposited 2017-03-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 22–128（107 aa）	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.3 M Lithium Sulfate 0.1M Tris ph7	Resolution 3.10 Å R-free 0.236
5V52 Structure of TIGIT bound to nectin-2 (CD112) Deposited 2017-03-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 22–128（107 aa）	Not recorded	SO4 SULFATE ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.3 M Lithium Sulfate 0.1M Tris ph7	Resolution 3.10 Å R-free 0.236
8JEL Crystal structure of TIGIT in complexed with Ociperlimab, crystal form I Deposited 2023-05-16	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain J 22–128（107 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M citric acid pH 4.6, 1 M lithium chloride, 7% PEG6000	Resolution 2.45 Å R-free 0.249
8JEL Crystal structure of TIGIT in complexed with Ociperlimab, crystal form I Deposited 2023-05-16	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 22–128（107 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M citric acid pH 4.6, 1 M lithium chloride, 7% PEG6000	Resolution 2.45 Å R-free 0.249
8JEL Crystal structure of TIGIT in complexed with Ociperlimab, crystal form I Deposited 2023-05-16	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain H 22–128（107 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M citric acid pH 4.6, 1 M lithium chloride, 7% PEG6000	Resolution 2.45 Å R-free 0.249
8JEL Crystal structure of TIGIT in complexed with Ociperlimab, crystal form I Deposited 2023-05-16	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain L 22–128（107 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M citric acid pH 4.6, 1 M lithium chloride, 7% PEG6000	Resolution 2.45 Å R-free 0.249
8JEN Crystal structure of TIGIT in complexed with Ociperlimab, crystal form II Deposited 2023-05-16	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain I 22–128（107 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M sodium citrate tribasic dihydrate pH 5.2, 17% PEG 20000	Resolution 2.71 Å R-free 0.289
8JEN Crystal structure of TIGIT in complexed with Ociperlimab, crystal form II Deposited 2023-05-16	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain J 22–128（107 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M sodium citrate tribasic dihydrate pH 5.2, 17% PEG 20000	Resolution 2.71 Å R-free 0.289
8JEN Crystal structure of TIGIT in complexed with Ociperlimab, crystal form II Deposited 2023-05-16	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain M 22–128（107 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M sodium citrate tribasic dihydrate pH 5.2, 17% PEG 20000	Resolution 2.71 Å R-free 0.289
8JEN Crystal structure of TIGIT in complexed with Ociperlimab, crystal form II Deposited 2023-05-16	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain P 22–128（107 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M sodium citrate tribasic dihydrate pH 5.2, 17% PEG 20000	Resolution 2.71 Å R-free 0.289
8JEO Crystal structure of TIGIT in complexed with Tiragolumab Deposited 2023-05-16	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 22–128（107 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M ammonium citrate tribasic pH 7.4, 14% PEG 3350	Resolution 2.06 Å R-free 0.205
8JEO Crystal structure of TIGIT in complexed with Tiragolumab Deposited 2023-05-16	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 22–128（107 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M ammonium citrate tribasic pH 7.4, 14% PEG 3350	Resolution 2.06 Å R-free 0.205
8SZY Crystal Structure of Heterotrimeric Anti-TIGIT Fabs in complex with human TIGIT Deposited 2023-05-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain T 23–128（106 aa）	Mutation：C69S	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；300 K；0.2 M sodium phosphate monobasic monohydrate, 20% w/v Polyethylene glycol 1,000	Resolution 2.31 Å R-free 0.269
8SZY Crystal Structure of Heterotrimeric Anti-TIGIT Fabs in complex with human TIGIT Deposited 2023-05-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain U 23–128（106 aa）	Mutation：C69S	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；300 K；0.2 M sodium phosphate monobasic monohydrate, 20% w/v Polyethylene glycol 1,000	Resolution 2.31 Å R-free 0.269
8VTD Co-structure of the Fab of the anti-TIGIT Vibostolimab antibody with its antigen Deposited 2024-01-26	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 22–137（116 aa）	Not recorded	GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；300 K；16% w/v PEG 20K	Resolution 1.23 Å R-free 0.204
8VTE Co-structure of the Fab of the anti-TIGIT Vibostolimab antibody with its antigen Deposited 2024-01-26	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 22–137（116 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；300 K；0.02M D-Glucose; 0.02M D-Mannose; 0.02M D-Galactose; 0.02M L-Fucose; 0.02M D-Xylose; 0.02M N-Acetyl-D-Glucosamine; 0.1M Imidazole, 0.1M MES; 20%v/v Glycerol; 10% PEG4K	Resolution 2.29 Å R-free 0.268
8VTE Co-structure of the Fab of the anti-TIGIT Vibostolimab antibody with its antigen Deposited 2024-01-26	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 22–137（116 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；300 K；0.02M D-Glucose; 0.02M D-Mannose; 0.02M D-Galactose; 0.02M L-Fucose; 0.02M D-Xylose; 0.02M N-Acetyl-D-Glucosamine; 0.1M Imidazole, 0.1M MES; 20%v/v Glycerol; 10% PEG4K	Resolution 2.29 Å R-free 0.268

11 other PDB entries and 23 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TIGIT_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–107； UniProt 23–129 Author chain T； PDBConstruct 1–107； UniProt 23–129

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7vyt
Deposition date deposition_date	2021-11-15
Structure title title	Crystal structure of human TIGIT(23-129) in complex with the scFv fragment of anti-TIGIT antibody MG1131
Keywords keywords	Antibody, Immune Checkpoint, TIGIT, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	29.08 Å
Radius of gyration Rg (electron density) rg_electron	28.55 Å
Forward intensity I(0) i0	89849800.00
Molecular weight molecular_weight	73033.0 kDa
Excluded volume excluded_volume	90539 Å³
Envelope volume envelope_volume	112250 Å³
Hydration-shell volume shell_volume	32975 Å³
Envelope diameter envelope_diameter	103.5 Å
Shell Rg shell_rg	35.37 Å
Envelope Rg envelope_rg	28.38 Å
Shape Rg shape_rg	28.50 Å
Total Rg total_rg	29.34 Å
Total atoms total_atoms	5140
Residues n_residues	664
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	93.8 Å
Rg (real space) rg_real	29.10 Å
Rg uncertainty (real space) rg_real_error	0.64 Å
I(0) (real space) i0_real	8.9850e+07
I(0) uncertainty (real space) i0_real_error	1.3620e+06
Rg (reciprocal space) rg_reciprocal	29.09 Å
I(0) (reciprocal space) i0_reciprocal	89850000.0000
Solution quality estimate total_estimate	0.8750
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	92.1 Å
Skewness Skewness skewness	0.382
Kurtosis Kurtosis kurtosis	-0.253
Angular range angular_range	— – 0.2750 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	22340000.0000
Real-space data points n_real_points	56
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.905; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.979; Smooth: 0.676

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	T-cell immunoreceptor with Ig and ITIM domains
Molecular weight formula_weight	11643.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,T
Atom count atom_count	5528

MTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICNADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVLES

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	MG1131 heavy chain variable region
Molecular weight formula_weight	13277.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,H

MEVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGIINPSGGSTSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCASRSGSGWFGALDYWGQGTLVTVSS

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	MG1131 light chain variable region
Molecular weight formula_weight	13560.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,C

GGGGSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPGGTFGQGTKVEIKRVDKLA

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 4 Entity 4 non-polymer

Description description	CITRATE ANION
Molecular weight formula_weight	189.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	388

▼

7. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	7vytB01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	7vytH01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

8. Citations (1)

▶

Unit-cell length a length_a	69.670 Å
Unit-cell length b length_b	79.820 Å
Unit-cell length c length_c	77.970 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	100.55 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	monoclinic

Resolution resolution	1.530 Å
Low-resolution limit resolution_low	29.330 Å
R factor r_factor	0.2021
R_work r_work	0.2012
R_free r_free	0.2190

fit	/app/data/saxs_computation/vy/7vyt/7vyt.fit
pddf	/app/data/pr_computation/vy/7vyt/7vyt.pr.out
profile	/app/data/saxs_computation/vy/7vyt/7vyt.dat

Crystal structure of human TIGIT(23-129) in complex with the scFv fragment of anti-TIGIT antibody MG1131

1. Protein Identity and Related Structures Protein Identity & Related Structures

T-cell immunoreceptor with Ig and ITIM domains

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)