3udw

Crystal structure of the immunoreceptor TIGIT in complex with Poliovirus receptor (PVR/CD155/necl-5) D1 domain

Method: X-RAY DIFFRACTION D_max: 101.4 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

T cell immunoreceptor with Ig and ITIM domains

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain A； UniProt 20–128 Chain B； UniProt 20–128	Fragment：TIGIT, UNP residues 20-128	Poliovirus receptor × 2 （P15151） NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 5.5；298 K；0.1 M Ammonium acetate 0.1 M Bis-Tris pH 5.5 17% PEG 10000, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.90 Å R-free 0.287

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 3UDW	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3Q0H Structure of T-cell immunoreceptor with immunoglobulin and ITIM domains (TIGIT) Deposited 2010-12-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 22–137（116 aa） Fragment：Ig-like V-type domain residues 22-137	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；1.3M Ammonium Sulfate, 0.1M MES pH 6.0, Vapor diffusion, Sitting drop, temperature 298K	Resolution 1.70 Å R-free 0.237
3Q0H Structure of T-cell immunoreceptor with immunoglobulin and ITIM domains (TIGIT) Deposited 2010-12-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 22–137（116 aa） Fragment：Ig-like V-type domain residues 22-137	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；1.3M Ammonium Sulfate, 0.1M MES pH 6.0, Vapor diffusion, Sitting drop, temperature 298K	Resolution 1.70 Å R-free 0.237
3RQ3 Structure of T-cell immunoreceptor with immunoglobulin and ITIM domains (TIGIT) in hexagonal crystal form Deposited 2011-04-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 22–137（116 aa） Fragment：UNP residues 22-137 Chain B 22–137（116 aa） Fragment：UNP residues 22-137	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；1.0M Ammonium Sulfate, 0.1M BIS-TRIS pH 5.5, 1% PEG3350, Vapor diffusion, Sitting drop, temperature 298K	Resolution 2.70 Å R-free 0.253
3UCR Crystal structure of the immunoreceptor TIGIT IgV domain Deposited 2011-10-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 23–128（106 aa） Fragment：UNP residues 23-128 Chain C 23–128（106 aa） Fragment：UNP residues 23-128	Not recorded	CL CHLORIDE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；1.5 M (NH4)2SO4 and 0.1M HEPES pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.63 Å R-free 0.274
3UCR Crystal structure of the immunoreceptor TIGIT IgV domain Deposited 2011-10-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 23–128（106 aa） Fragment：UNP residues 23-128 Chain D 23–128（106 aa） Fragment：UNP residues 23-128	Not recorded	CL CHLORIDE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；1.5 M (NH4)2SO4 and 0.1M HEPES pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.63 Å R-free 0.274
5V52 Structure of TIGIT bound to nectin-2 (CD112) Deposited 2017-03-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 22–128（107 aa）	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.3 M Lithium Sulfate 0.1M Tris ph7	Resolution 3.10 Å R-free 0.236
5V52 Structure of TIGIT bound to nectin-2 (CD112) Deposited 2017-03-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 22–128（107 aa）	Not recorded	SO4 SULFATE ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.3 M Lithium Sulfate 0.1M Tris ph7	Resolution 3.10 Å R-free 0.236
7VYT Crystal structure of human TIGIT(23-129) in complex with the scFv fragment of anti-TIGIT antibody MG1131 Deposited 2021-11-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 23–129（107 aa）	Not recorded	FLC CITRATE ANION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293.15 K；200mM ammonium citrate, 20% (v/v) polyethylene glycol 3350	Resolution 1.53 Å R-free 0.219
7VYT Crystal structure of human TIGIT(23-129) in complex with the scFv fragment of anti-TIGIT antibody MG1131 Deposited 2021-11-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 23–129（107 aa）	Not recorded	FLC CITRATE ANION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293.15 K；200mM ammonium citrate, 20% (v/v) polyethylene glycol 3350	Resolution 1.53 Å R-free 0.219
8JEL Crystal structure of TIGIT in complexed with Ociperlimab, crystal form I Deposited 2023-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain J 22–128（107 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M citric acid pH 4.6, 1 M lithium chloride, 7% PEG6000	Resolution 2.45 Å R-free 0.249
8JEL Crystal structure of TIGIT in complexed with Ociperlimab, crystal form I Deposited 2023-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 22–128（107 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M citric acid pH 4.6, 1 M lithium chloride, 7% PEG6000	Resolution 2.45 Å R-free 0.249
8JEL Crystal structure of TIGIT in complexed with Ociperlimab, crystal form I Deposited 2023-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain H 22–128（107 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M citric acid pH 4.6, 1 M lithium chloride, 7% PEG6000	Resolution 2.45 Å R-free 0.249
8JEL Crystal structure of TIGIT in complexed with Ociperlimab, crystal form I Deposited 2023-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain L 22–128（107 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M citric acid pH 4.6, 1 M lithium chloride, 7% PEG6000	Resolution 2.45 Å R-free 0.249
8JEN Crystal structure of TIGIT in complexed with Ociperlimab, crystal form II Deposited 2023-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain I 22–128（107 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M sodium citrate tribasic dihydrate pH 5.2, 17% PEG 20000	Resolution 2.71 Å R-free 0.289
8JEN Crystal structure of TIGIT in complexed with Ociperlimab, crystal form II Deposited 2023-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain J 22–128（107 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M sodium citrate tribasic dihydrate pH 5.2, 17% PEG 20000	Resolution 2.71 Å R-free 0.289
8JEN Crystal structure of TIGIT in complexed with Ociperlimab, crystal form II Deposited 2023-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain M 22–128（107 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M sodium citrate tribasic dihydrate pH 5.2, 17% PEG 20000	Resolution 2.71 Å R-free 0.289
8JEN Crystal structure of TIGIT in complexed with Ociperlimab, crystal form II Deposited 2023-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain P 22–128（107 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M sodium citrate tribasic dihydrate pH 5.2, 17% PEG 20000	Resolution 2.71 Å R-free 0.289
8JEO Crystal structure of TIGIT in complexed with Tiragolumab Deposited 2023-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 22–128（107 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M ammonium citrate tribasic pH 7.4, 14% PEG 3350	Resolution 2.06 Å R-free 0.205
8JEO Crystal structure of TIGIT in complexed with Tiragolumab Deposited 2023-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 22–128（107 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M ammonium citrate tribasic pH 7.4, 14% PEG 3350	Resolution 2.06 Å R-free 0.205
8SZY Crystal Structure of Heterotrimeric Anti-TIGIT Fabs in complex with human TIGIT Deposited 2023-05-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain T 23–128（106 aa）	Mutation：C69S	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；300 K；0.2 M sodium phosphate monobasic monohydrate, 20% w/v Polyethylene glycol 1,000	Resolution 2.31 Å R-free 0.269
8SZY Crystal Structure of Heterotrimeric Anti-TIGIT Fabs in complex with human TIGIT Deposited 2023-05-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain U 23–128（106 aa）	Mutation：C69S	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；300 K；0.2 M sodium phosphate monobasic monohydrate, 20% w/v Polyethylene glycol 1,000	Resolution 2.31 Å R-free 0.269
8VTD Co-structure of the Fab of the anti-TIGIT Vibostolimab antibody with its antigen Deposited 2024-01-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 22–137（116 aa）	Not recorded	GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；300 K；16% w/v PEG 20K	Resolution 1.23 Å R-free 0.204
8VTE Co-structure of the Fab of the anti-TIGIT Vibostolimab antibody with its antigen Deposited 2024-01-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 22–137（116 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；300 K；0.02M D-Glucose; 0.02M D-Mannose; 0.02M D-Galactose; 0.02M L-Fucose; 0.02M D-Xylose; 0.02M N-Acetyl-D-Glucosamine; 0.1M Imidazole, 0.1M MES; 20%v/v Glycerol; 10% PEG4K	Resolution 2.29 Å R-free 0.268
8VTE Co-structure of the Fab of the anti-TIGIT Vibostolimab antibody with its antigen Deposited 2024-01-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 22–137（116 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；300 K；0.02M D-Glucose; 0.02M D-Mannose; 0.02M D-Galactose; 0.02M L-Fucose; 0.02M D-Xylose; 0.02M N-Acetyl-D-Glucosamine; 0.1M Imidazole, 0.1M MES; 20%v/v Glycerol; 10% PEG4K	Resolution 2.29 Å R-free 0.268

11 other PDB entries and 24 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TIGIT_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–110； UniProt 20–128 Author chain B； PDBConstruct 2–110； UniProt 20–128

Poliovirus receptor

Homo sapiens

UniProt P15151

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain C； UniProt 28–145 Chain D； UniProt 28–145	Fragment：PVR, UNP residues 28-145	T cell immunoreceptor with Ig and ITIM domains × 2 （Q495A1） NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 5.5；298 K；0.1 M Ammonium acetate 0.1 M Bis-Tris pH 5.5 17% PEG 10000, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.90 Å R-free 0.287

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 3UDW	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1DGI Cryo-EM structure of human poliovirus(serotype 1)complexed with three domain CD155 Deposited 1999-11-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: 300-MERIC	Chain R 28–329（302 aa） Fragment：THREE EXTRACELLULAR DOMAINS OF CD155	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions POLIOVIRUS WAS INCUBATED WITH CD155-AP FOR 1 HOURS AT 4 DEGREES CELSIUS (277 KELVIN) USING A EIGHT-FOLD EXCESS OF CD155-AP FOR EACH OF THE SIXTY POSSIBLE BINDING SITES PER VIRION. AFTER INCUBATION, SAMPLES WERE PREPARED AS THIN LAYERS OF VITREOUS ICE AND MAINTAINED AT NEAR LIQUID NITROGEN TEMPERATURE IN THE ELECTRON MICROSCOPE WITH A GATAN 626 CRYOTRANSFER HOLDER. X-ray crystallization conditions ELECTRON MICROSCOPY RECONSTRUCTION；pH 7.5；WARNING: THIS IS AN ELECTRON MICROSCOPY MODEL DEPOSITION. CRYO-EM INFORMATION HAS BEEN INCLUDED IN THE FORM OF REMARK 250 RECORDS AT THE TOP OF THE PDB COORDINATE FILE., pH 7.5, ELECTRON MICROSCOPY RECONSTRUCTION	Resolution 22.00 Å
1DGI Cryo-EM structure of human poliovirus(serotype 1)complexed with three domain CD155 Deposited 1999-11-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain R 28–329（302 aa） Fragment：THREE EXTRACELLULAR DOMAINS OF CD155	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions POLIOVIRUS WAS INCUBATED WITH CD155-AP FOR 1 HOURS AT 4 DEGREES CELSIUS (277 KELVIN) USING A EIGHT-FOLD EXCESS OF CD155-AP FOR EACH OF THE SIXTY POSSIBLE BINDING SITES PER VIRION. AFTER INCUBATION, SAMPLES WERE PREPARED AS THIN LAYERS OF VITREOUS ICE AND MAINTAINED AT NEAR LIQUID NITROGEN TEMPERATURE IN THE ELECTRON MICROSCOPE WITH A GATAN 626 CRYOTRANSFER HOLDER. X-ray crystallization conditions ELECTRON MICROSCOPY RECONSTRUCTION；pH 7.5；WARNING: THIS IS AN ELECTRON MICROSCOPY MODEL DEPOSITION. CRYO-EM INFORMATION HAS BEEN INCLUDED IN THE FORM OF REMARK 250 RECORDS AT THE TOP OF THE PDB COORDINATE FILE., pH 7.5, ELECTRON MICROSCOPY RECONSTRUCTION	Resolution 22.00 Å
1DGI Cryo-EM structure of human poliovirus(serotype 1)complexed with three domain CD155 Deposited 1999-11-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain R 28–329（302 aa） Fragment：THREE EXTRACELLULAR DOMAINS OF CD155	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions POLIOVIRUS WAS INCUBATED WITH CD155-AP FOR 1 HOURS AT 4 DEGREES CELSIUS (277 KELVIN) USING A EIGHT-FOLD EXCESS OF CD155-AP FOR EACH OF THE SIXTY POSSIBLE BINDING SITES PER VIRION. AFTER INCUBATION, SAMPLES WERE PREPARED AS THIN LAYERS OF VITREOUS ICE AND MAINTAINED AT NEAR LIQUID NITROGEN TEMPERATURE IN THE ELECTRON MICROSCOPE WITH A GATAN 626 CRYOTRANSFER HOLDER. X-ray crystallization conditions ELECTRON MICROSCOPY RECONSTRUCTION；pH 7.5；WARNING: THIS IS AN ELECTRON MICROSCOPY MODEL DEPOSITION. CRYO-EM INFORMATION HAS BEEN INCLUDED IN THE FORM OF REMARK 250 RECORDS AT THE TOP OF THE PDB COORDINATE FILE., pH 7.5, ELECTRON MICROSCOPY RECONSTRUCTION	Resolution 22.00 Å
1DGI Cryo-EM structure of human poliovirus(serotype 1)complexed with three domain CD155 Deposited 1999-11-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain R 28–329（302 aa） Fragment：THREE EXTRACELLULAR DOMAINS OF CD155	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions POLIOVIRUS WAS INCUBATED WITH CD155-AP FOR 1 HOURS AT 4 DEGREES CELSIUS (277 KELVIN) USING A EIGHT-FOLD EXCESS OF CD155-AP FOR EACH OF THE SIXTY POSSIBLE BINDING SITES PER VIRION. AFTER INCUBATION, SAMPLES WERE PREPARED AS THIN LAYERS OF VITREOUS ICE AND MAINTAINED AT NEAR LIQUID NITROGEN TEMPERATURE IN THE ELECTRON MICROSCOPE WITH A GATAN 626 CRYOTRANSFER HOLDER. X-ray crystallization conditions ELECTRON MICROSCOPY RECONSTRUCTION；pH 7.5；WARNING: THIS IS AN ELECTRON MICROSCOPY MODEL DEPOSITION. CRYO-EM INFORMATION HAS BEEN INCLUDED IN THE FORM OF REMARK 250 RECORDS AT THE TOP OF THE PDB COORDINATE FILE., pH 7.5, ELECTRON MICROSCOPY RECONSTRUCTION	Resolution 22.00 Å
1DGI Cryo-EM structure of human poliovirus(serotype 1)complexed with three domain CD155 Deposited 1999-11-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain R 28–329（302 aa） Fragment：THREE EXTRACELLULAR DOMAINS OF CD155	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions POLIOVIRUS WAS INCUBATED WITH CD155-AP FOR 1 HOURS AT 4 DEGREES CELSIUS (277 KELVIN) USING A EIGHT-FOLD EXCESS OF CD155-AP FOR EACH OF THE SIXTY POSSIBLE BINDING SITES PER VIRION. AFTER INCUBATION, SAMPLES WERE PREPARED AS THIN LAYERS OF VITREOUS ICE AND MAINTAINED AT NEAR LIQUID NITROGEN TEMPERATURE IN THE ELECTRON MICROSCOPE WITH A GATAN 626 CRYOTRANSFER HOLDER. X-ray crystallization conditions ELECTRON MICROSCOPY RECONSTRUCTION；pH 7.5；WARNING: THIS IS AN ELECTRON MICROSCOPY MODEL DEPOSITION. CRYO-EM INFORMATION HAS BEEN INCLUDED IN THE FORM OF REMARK 250 RECORDS AT THE TOP OF THE PDB COORDINATE FILE., pH 7.5, ELECTRON MICROSCOPY RECONSTRUCTION	Resolution 22.00 Å
1NN8 CryoEM structure of poliovirus receptor bound to poliovirus Deposited 2003-01-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 420 PDB declaration: 420-MERIC	Chain R 28–329（302 aa） Chain S 28–329（302 aa） Chain T 28–329（302 aa）	Not recorded	MYR MYRISTIC ACID × 60	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 15.00 Å
1NN8 CryoEM structure of poliovirus receptor bound to poliovirus Deposited 2003-01-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain R 28–329（302 aa） Chain S 28–329（302 aa） Chain T 28–329（302 aa）	Not recorded	MYR MYRISTIC ACID × 1	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 15.00 Å
1NN8 CryoEM structure of poliovirus receptor bound to poliovirus Deposited 2003-01-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain R 28–329（302 aa） Chain S 28–329（302 aa） Chain T 28–329（302 aa）	Not recorded	MYR MYRISTIC ACID × 5	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 15.00 Å
1NN8 CryoEM structure of poliovirus receptor bound to poliovirus Deposited 2003-01-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 42 PDB declaration: 42-meric	Chain R 28–329（302 aa） Chain S 28–329（302 aa） Chain T 28–329（302 aa）	Not recorded	MYR MYRISTIC ACID × 6	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 15.00 Å
1NN8 CryoEM structure of poliovirus receptor bound to poliovirus Deposited 2003-01-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain R 28–329（302 aa） Chain S 28–329（302 aa） Chain T 28–329（302 aa）	Not recorded	MYR MYRISTIC ACID × 1	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 15.00 Å
3EPC CryoEM structure of poliovirus receptor bound to poliovirus type 1 Deposited 2008-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: 300-MERIC	Chain R 30–242（213 aa） Fragment：Poliovirus receptor CD155 D1D2	Mutation：N105D, N120S, N188Q, N218Q, N237S	SPH SPHINGOSINE × 60 MYR MYRISTIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.00 Å
3EPC CryoEM structure of poliovirus receptor bound to poliovirus type 1 Deposited 2008-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain R 30–242（213 aa） Fragment：Poliovirus receptor CD155 D1D2	Mutation：N105D, N120S, N188Q, N218Q, N237S	SPH SPHINGOSINE × 1 MYR MYRISTIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.00 Å
3EPC CryoEM structure of poliovirus receptor bound to poliovirus type 1 Deposited 2008-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain R 30–242（213 aa） Fragment：Poliovirus receptor CD155 D1D2	Mutation：N105D, N120S, N188Q, N218Q, N237S	SPH SPHINGOSINE × 5 MYR MYRISTIC ACID × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.00 Å
3EPC CryoEM structure of poliovirus receptor bound to poliovirus type 1 Deposited 2008-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain R 30–242（213 aa） Fragment：Poliovirus receptor CD155 D1D2	Mutation：N105D, N120S, N188Q, N218Q, N237S	SPH SPHINGOSINE × 6 MYR MYRISTIC ACID × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.00 Å
3EPC CryoEM structure of poliovirus receptor bound to poliovirus type 1 Deposited 2008-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain R 30–242（213 aa） Fragment：Poliovirus receptor CD155 D1D2	Mutation：N105D, N120S, N188Q, N218Q, N237S	SPH SPHINGOSINE × 1 MYR MYRISTIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.00 Å
3EPD CryoEM structure of poliovirus receptor bound to poliovirus type 3 Deposited 2008-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 360 PDB declaration: 360-MERIC	Chain R 30–242（213 aa） Fragment：Poliovirus receptor CD155 D1D2	Mutation：N105D, N120S, N188Q, N218Q, N237S	SPH SPHINGOSINE × 60 MYR MYRISTIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
3EPD CryoEM structure of poliovirus receptor bound to poliovirus type 3 Deposited 2008-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain R 30–242（213 aa） Fragment：Poliovirus receptor CD155 D1D2	Mutation：N105D, N120S, N188Q, N218Q, N237S	SPH SPHINGOSINE × 1 MYR MYRISTIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
3EPD CryoEM structure of poliovirus receptor bound to poliovirus type 3 Deposited 2008-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain R 30–242（213 aa） Fragment：Poliovirus receptor CD155 D1D2	Mutation：N105D, N120S, N188Q, N218Q, N237S	SPH SPHINGOSINE × 5 MYR MYRISTIC ACID × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
3EPD CryoEM structure of poliovirus receptor bound to poliovirus type 3 Deposited 2008-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain R 30–242（213 aa） Fragment：Poliovirus receptor CD155 D1D2	Mutation：N105D, N120S, N188Q, N218Q, N237S	SPH SPHINGOSINE × 6 MYR MYRISTIC ACID × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
3EPD CryoEM structure of poliovirus receptor bound to poliovirus type 3 Deposited 2008-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain R 30–242（213 aa） Fragment：Poliovirus receptor CD155 D1D2	Mutation：N105D, N120S, N188Q, N218Q, N237S	SPH SPHINGOSINE × 1 MYR MYRISTIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
3EPF CryoEM structure of poliovirus receptor bound to poliovirus type 2 Deposited 2008-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: 300-MERIC	Chain R 30–242（213 aa） Fragment：Poliovirus receptor CD155 D1D2	Mutation：N105D, N120S, N188Q, N218Q, N237S	SC4 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 60 MYR MYRISTIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
3EPF CryoEM structure of poliovirus receptor bound to poliovirus type 2 Deposited 2008-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain R 30–242（213 aa） Fragment：Poliovirus receptor CD155 D1D2	Mutation：N105D, N120S, N188Q, N218Q, N237S	SC4 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 1 MYR MYRISTIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
3EPF CryoEM structure of poliovirus receptor bound to poliovirus type 2 Deposited 2008-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain R 30–242（213 aa） Fragment：Poliovirus receptor CD155 D1D2	Mutation：N105D, N120S, N188Q, N218Q, N237S	SC4 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 5 MYR MYRISTIC ACID × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
3EPF CryoEM structure of poliovirus receptor bound to poliovirus type 2 Deposited 2008-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain R 30–242（213 aa） Fragment：Poliovirus receptor CD155 D1D2	Mutation：N105D, N120S, N188Q, N218Q, N237S	SC4 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 6 MYR MYRISTIC ACID × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
3EPF CryoEM structure of poliovirus receptor bound to poliovirus type 2 Deposited 2008-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain R 30–242（213 aa） Fragment：Poliovirus receptor CD155 D1D2	Mutation：N105D, N120S, N188Q, N218Q, N237S	SC4 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 1 MYR MYRISTIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
3J8F Cryo-EM reconstruction of poliovirus-receptor complex Deposited 2014-10-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 300 PDB declaration: 300-meric	Chain 7 1–417（417 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 60	ELECTRON MICROSCOPY cryo-EM buffer PBS；pH 7；PBS cryo-EM vitrification conditions Sample mixed and frozen within 2 minutes.；120 K；Cryogen ETHANE；Sample mixed and frozen within 2 minutes before plunging into liquid ethane.	Resolution 3.70 Å
3J8F Cryo-EM reconstruction of poliovirus-receptor complex Deposited 2014-10-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain 7 1–417（417 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer PBS；pH 7；PBS cryo-EM vitrification conditions Sample mixed and frozen within 2 minutes.；120 K；Cryogen ETHANE；Sample mixed and frozen within 2 minutes before plunging into liquid ethane.	Resolution 3.70 Å
3J8F Cryo-EM reconstruction of poliovirus-receptor complex Deposited 2014-10-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 25 PDB declaration: 25-meric	Chain 7 1–417（417 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	ELECTRON MICROSCOPY cryo-EM buffer PBS；pH 7；PBS cryo-EM vitrification conditions Sample mixed and frozen within 2 minutes.；120 K；Cryogen ETHANE；Sample mixed and frozen within 2 minutes before plunging into liquid ethane.	Resolution 3.70 Å
3J8F Cryo-EM reconstruction of poliovirus-receptor complex Deposited 2014-10-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 30 PDB declaration: 30-meric	Chain 7 1–417（417 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM buffer PBS；pH 7；PBS cryo-EM vitrification conditions Sample mixed and frozen within 2 minutes.；120 K；Cryogen ETHANE；Sample mixed and frozen within 2 minutes before plunging into liquid ethane.	Resolution 3.70 Å
3J8F Cryo-EM reconstruction of poliovirus-receptor complex Deposited 2014-10-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain 7 1–417（417 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer PBS；pH 7；PBS cryo-EM vitrification conditions Sample mixed and frozen within 2 minutes.；120 K；Cryogen ETHANE；Sample mixed and frozen within 2 minutes before plunging into liquid ethane.	Resolution 3.70 Å
3J9F Poliovirus complexed with soluble, deglycosylated poliovirus receptor (Pvr) at 4 degrees C Deposited 2015-01-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 420 PDB declaration: 420-meric	Chain 7 28–143（116 aa） Fragment：SEE REMARK 999 Chain 8 142–243（102 aa） Fragment：SEE REMARK 999 Chain 9 242–333（92 aa） Fragment：SEE REMARK 999	Not recorded	PLM PALMITIC ACID × 60 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 60	ELECTRON MICROSCOPY cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
3J9F Poliovirus complexed with soluble, deglycosylated poliovirus receptor (Pvr) at 4 degrees C Deposited 2015-01-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain 7 28–143（116 aa） Fragment：SEE REMARK 999 Chain 8 142–243（102 aa） Fragment：SEE REMARK 999 Chain 9 242–333（92 aa） Fragment：SEE REMARK 999	Not recorded	PLM PALMITIC ACID × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
3J9F Poliovirus complexed with soluble, deglycosylated poliovirus receptor (Pvr) at 4 degrees C Deposited 2015-01-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 35 PDB declaration: 35-meric	Chain 7 28–143（116 aa） Fragment：SEE REMARK 999 Chain 8 142–243（102 aa） Fragment：SEE REMARK 999 Chain 9 242–333（92 aa） Fragment：SEE REMARK 999	Not recorded	PLM PALMITIC ACID × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	ELECTRON MICROSCOPY cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
3J9F Poliovirus complexed with soluble, deglycosylated poliovirus receptor (Pvr) at 4 degrees C Deposited 2015-01-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 42 PDB declaration: 42-meric	Chain 7 28–143（116 aa） Fragment：SEE REMARK 999 Chain 8 142–243（102 aa） Fragment：SEE REMARK 999 Chain 9 242–333（92 aa） Fragment：SEE REMARK 999	Not recorded	PLM PALMITIC ACID × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
3J9F Poliovirus complexed with soluble, deglycosylated poliovirus receptor (Pvr) at 4 degrees C Deposited 2015-01-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain 7 28–143（116 aa） Fragment：SEE REMARK 999 Chain 8 142–243（102 aa） Fragment：SEE REMARK 999 Chain 9 242–333（92 aa） Fragment：SEE REMARK 999	Not recorded	PLM PALMITIC ACID × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
3URO Poliovirus receptor CD155 D1D2 Deposited 2011-11-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain R 29–243（215 aa） Fragment：poliovirus receptor CD155 D1D2 (UNP Residues 29-243)	Mutation：N105D, N120S, N188Q, N218Q, N237S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；100 mM MgSO4, 6.8 M NH4NO3, 100 mM Tris buffer, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.50 Å R-free 0.341
3URO Poliovirus receptor CD155 D1D2 Deposited 2011-11-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain R 29–243（215 aa） Fragment：poliovirus receptor CD155 D1D2 (UNP Residues 29-243)	Mutation：N105D, N120S, N188Q, N218Q, N237S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；100 mM MgSO4, 6.8 M NH4NO3, 100 mM Tris buffer, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.50 Å R-free 0.341
4FQP Crystal structure of human Nectin-like 5 full ectodomain (D1-D3) Deposited 2012-06-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 28–334（307 aa） Fragment：ectodomain (D1-D3, UNP residues 28-334)	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；293.15 K；55% v/v tacsimate, 0.1 M Bicine, pH 9.0, with additional 10% tacsimate as cryoprotectant, VAPOR DIFFUSION, HANGING DROP, temperature 293.15K	Resolution 3.60 Å R-free 0.272
6ARQ Crystal structure of CD96 (D1) bound to CD155/necl-5 (D1-3) Deposited 2017-08-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 28–334（307 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；32% (v/v) Jeffamine ED-2001 0.1M HEPES pH7.3	Resolution 2.88 Å R-free 0.252
6ISC complex structure of mCD226-ecto and hCD155-D1 Deposited 2018-11-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 28–145（118 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；0.1 M Tris (pH 8.0), 0.15 M ammonium sulfate, and 15% (w/v) PEG4000	Resolution 2.20 Å R-free 0.265
6O3O Structure of human DNAM-1 (CD226) bound to nectin-like protein-5 (necl-5) Deposited 2019-02-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 28–334（307 aa） Chain D 28–334（307 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；20% PEG3350, 0.18M K2SO4, 10mM EDTA	Resolution 2.80 Å R-free 0.231

12 other PDB entries and 41 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PVR_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–118； UniProt 28–145 Author chain D； PDBConstruct 1–118； UniProt 28–145

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3udw
Deposition date deposition_date	2011-10-28
Structure title title	Crystal structure of the immunoreceptor TIGIT in complex with Poliovirus receptor (PVR/CD155/necl-5) D1 domain
Keywords keywords	;PVR TIGIT IgSF Signal transduction Immunology, IgSF, Cell surface receptor Signalling, glycosylation, Membrane protein, SIGNALING PROTEIN ;; SIGNALING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	28.77 Å
Radius of gyration Rg (electron density) rg_electron	28.86 Å
Forward intensity I(0) i0	40253200.00
Molecular weight molecular_weight	48974.0 kDa
Excluded volume excluded_volume	61027 Å³
Envelope volume envelope_volume	77627 Å³
Hydration-shell volume shell_volume	24401 Å³
Envelope diameter envelope_diameter	108.4 Å
Shell Rg shell_rg	33.34 Å
Envelope Rg envelope_rg	29.00 Å
Shape Rg shape_rg	28.84 Å
Total Rg total_rg	29.37 Å
Total atoms total_atoms	3447
Residues n_residues	439
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	101.4 Å
Rg (real space) rg_real	29.06 Å
Rg uncertainty (real space) rg_real_error	0.95 Å
I(0) (real space) i0_real	4.0250e+07
I(0) uncertainty (real space) i0_real_error	5.7900e+05
Rg (reciprocal space) rg_reciprocal	28.94 Å
I(0) (reciprocal space) i0_reciprocal	40250000.0000
Solution quality estimate total_estimate	0.8023
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	25.8 Å
Skewness Skewness skewness	0.585
Kurtosis Kurtosis kurtosis	-0.216
Angular range angular_range	— – 0.2750 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	12970000.0000
Real-space data points n_real_points	56
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.689; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.499; Smooth: 0.859

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	T cell immunoreceptor with Ig and ITIM domains
Molecular weight formula_weight	11970.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	3447

GSHMMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICNADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVLE

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Poliovirus receptor
Molecular weight formula_weight	13095.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

DVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKP

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Spodoptera frugiperda

Entity 3 Entity 3 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	man
Copy count entity_count	4

▼

7. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d3udwa_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.0 — automated matches

Domain ID domain_id	d3udwb_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.0 — automated matches

Domain ID domain_id	d3udwc_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.0 — automated matches

Domain ID domain_id	d3udwd_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.0 — automated matches

CATH v4.4 (4 domains)

Domain ID domain_id	3udwA00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3udwB00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3udwC00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3udwD00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

8. Citations (1)

▶

Unit-cell length a length_a	95.606 Å
Unit-cell length b length_b	95.606 Å
Unit-cell length c length_c	149.614 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 32 2 1
Space-group number int_tables_number	154
Crystal system crystal_system	—

Resolution resolution	2.903 Å
Low-resolution limit resolution_low	27.599 Å
R factor r_factor	0.2526
R_work r_work	0.2507
R_free r_free	0.2869

fit	/app/data/saxs_computation/ud/3udw/3udw.fit
pddf	/app/data/pr_computation/ud/3udw/3udw.pr.out
profile	/app/data/saxs_computation/ud/3udw/3udw.dat

Crystal structure of the immunoreceptor TIGIT in complex with Poliovirus receptor (PVR/CD155/necl-5) D1 domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

T cell immunoreceptor with Ig and ITIM domains

State in the Current Structure

Other States of the Same Protein in the Database

Poliovirus receptor

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

7. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)