3epf

CryoEM structure of poliovirus receptor bound to poliovirus type 2

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Poliovirus receptor

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 300	Protein VP1 × 60 （P06210） Protein VP2 × 60 （P06210） Protein VP4 × 60 （P06210） Protein VP3 × 60 （P06210） 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 60 MYRISTIC ACID × 60 water × 240	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 5	Protein VP1 × 1 （P06210） Protein VP2 × 1 （P06210） Protein VP4 × 1 （P06210） Protein VP3 × 1 （P06210） 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 1 MYRISTIC ACID × 1 water × 4	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 25	Protein VP1 × 5 （P06210） Protein VP2 × 5 （P06210） Protein VP4 × 5 （P06210） Protein VP3 × 5 （P06210） 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 5 MYRISTIC ACID × 5 water × 20	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 30	Protein VP1 × 6 （P06210） Protein VP2 × 6 （P06210） Protein VP4 × 6 （P06210） Protein VP3 × 6 （P06210） 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 6 MYRISTIC ACID × 6 water × 24	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 5	Protein VP1 × 1 （P06210） Protein VP2 × 1 （P06210） Protein VP4 × 1 （P06210） Protein VP3 × 1 （P06210） 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 1 MYRISTIC ACID × 1 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PVR_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain R； PDBConstruct 1–213； UniProt 30–242

Protein VP1

Poliovirus type 2

UniProt P06210

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 300	Poliovirus receptor × 60 （P15151） 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 60 MYRISTIC ACID × 60 water × 240	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 5	Poliovirus receptor × 1 （P15151） 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 1 MYRISTIC ACID × 1 water × 4	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 25	Poliovirus receptor × 5 （P15151） 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 5 MYRISTIC ACID × 5 water × 20	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 30	Poliovirus receptor × 6 （P15151） 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 6 MYRISTIC ACID × 6 water × 24	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 5	Poliovirus receptor × 1 （P15151） 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 1 MYRISTIC ACID × 1 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POLG_POL2L
Isoform	—
PDB entities	2, 3, 4, 5
Chains and sequence ranges	Author chain 1； PDBConstruct 1–278； UniProt 602–879 Author chain 2； PDBConstruct 1–262； UniProt 79–340 Author chain 4； PDBConstruct 1–68； UniProt 2–69 Author chain 3； PDBConstruct 1–235； UniProt 341–575

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3epf
Deposition date deposition_date	2008-09-29
Structure title title	CryoEM structure of poliovirus receptor bound to poliovirus type 2
Keywords keywords	;CD155 structure Immunoglobulin Superfamily, poliovirus capsid jelly role, Cell adhesion, Cell membrane, Glycoprotein, Host-virus interaction, Immunoglobulin domain, Membrane, Receptor, Secreted, Transmembrane, VIRAL PROTEIN, VIRUS ;; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3epf__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3epf__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3epf__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	140.70 Å
Total Rg	140.70 Å
Atom count	491400
Residues	63000
Excluded volume	8728000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3epf__assembly_1__model_1`	300-MERIC （300）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3epf__assembly_2__model_1`	pentameric （5）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`3epf__assembly_3__model_1`	25-meric （25）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
4	1	`3epf__assembly_4__model_1`	30-meric （30）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
5	1	`3epf__assembly_5__model_1`	pentameric （5）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Poliovirus receptor
Molecular weight formula_weight	23330.5 kDa
Mutation mutation	N105D, N120S, N188Q, N218Q, N237S
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R
Atom count atom_count	8461

VVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRDASLRMFGLRVEDEGSYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPQTSQVPGFLSGTVTVTSLWILVPSSQVDGKQVTCKVEHESFEKPQLLTVSLTVYY

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Protein VP1
Molecular weight formula_weight	30734.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

ANNLPDTQSSGPAHSKETPALTAVETGATNPLVPSDTVQTRHVIQKRTRSESTVESFFARGACVAIIEVDNDAPTKRASKLFSVWKITYKDTVQLRRKLEFFTYSRFDMEFTFVVTSNYTDANNGHALNQVYQIMYIPPGAPIPGKWNDYTWQTSSNPSVFYTYGAPPARISVPYVGIANAYSHFYDGFAKVPLAGQASTEGDSLYGAASLNDFGSLAVRVVNDHNPTKLTSKIRVYMKPKHVRVWCPRPPRAVPYYGPGVDYKDGLAPLPGKGLTTY

Source Source

Source organism organism	Poliovirus type 2
NCBI taxonomy ID ncbi_taxonomy_id	12084
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Protein VP2
Molecular weight formula_weight	29045.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

SVRVMQLTLGNSTITTQEAANSVVAYGRWPEYIKDSEANPVDQPTEPDVAACRFYTLDTVTWRKESRGWWWKLPDALKDMGLFGQNMFYHYLGRAGYTVHVQCNASKFHQGALGVFAVPEMCLAGDSTTHMFTKYENANPGEKGGEFKGSFTLDTNATNPARNFCPVDYLFGSGVLAGNAFVYPHQIINLRTNNCATLVLPYVNSLSIDSMTKHNNWGIAILPLAPLDFATESSTEIPITLTIAPMCCEFNGLRNITVPRTQ

Source Source

Source organism organism	Poliovirus type 2
NCBI taxonomy ID ncbi_taxonomy_id	12084
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	Protein VP4
Molecular weight formula_weight	7347.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

GAQVSSQKVGAHENSNRAYGGSTINYTTINYYRDSASNAASKQDFAQDPSKFTEPIKDVLIKTAPTLN

Source Source

Source organism organism	Poliovirus type 2
NCBI taxonomy ID ncbi_taxonomy_id	12084
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	Protein VP3
Molecular weight formula_weight	26115.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

GLPVLNTPGSNQYLTADNYQSPCAIPEFDVTPPIDIPGEVRNMMELAEIDTMIPLNLTNQRKNTMDMYRVELNDAAHSDTPILCLSLSPASDPRLAHTMLGEILNYYTHWAGSLKFTFLFCGSMMATGKLLVSYAPPGAEAPKSRKEAMLGTHVIWDIGLQSSCTMVVPWISNTTYRQTINDSFTEGGYISMFYQTRVVVPLSTPRKMDILGFVSACNDFSVRLLRDTTHISQEA

Source Source

Source organism organism	Poliovirus type 2
NCBI taxonomy ID ncbi_taxonomy_id	12084
Host organism host_organism	Escherichia coli

Entity 6 Entity 6 non-polymer

Description description	1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE
Molecular weight formula_weight	423.7 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 7 Entity 7 non-polymer

Description description	MYRISTIC ACID
Molecular weight formula_weight	228.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 8 Entity 8 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	271

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	9.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	—

CryoEM structure of poliovirus receptor bound to poliovirus type 2

1. Protein Identity and Related Structures Protein Identity & Related Structures

Poliovirus receptor

State in the Current Structure

Other States of the Same Protein in the Database

Protein VP1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3epf__assembly_1__model_1

3epf__assembly_1__model_1 | I(q)

3epf__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

7. Citations (1)

CryoEM structure of poliovirus receptor bound to poliovirus type 2

1. Protein Identity and Related Structures Protein Identity & Related Structures

Poliovirus receptor

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein VP1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3epf__assembly_1__model_1

3epf__assembly_1__model_1 | I(q)

3epf__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

7. Citations (1)