SAXSdb — 8ayz

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Capsid protein, VP1

Human poliovirus 2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 180 PDB declaration: 180-meric（180） Consistent with protein copy count	Chain A； UniProt 579–879 Chain B； UniProt 1–340 Chain C； UniProt 342–578	Not recorded	SPH SPHINGOSINE × 60 FHK 4-[[4-[1,3-bis(oxidanylidene)isoindol-2-yl]phenyl]sulfonylamino]benzoic acid × 60	ELECTRON MICROSCOPY cryo-EM buffer：pH 7；1 x DPBS was made from tissue culture grade Dulbecco's Phosphate Buffered Saline (Sigma-Aldrich). 20 mM EDTA was prepared from fresh stocks of buffered EDTA. cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE；Single blotting with 3.5ul of sample. Four second blot time and -17 blot force on the vitrobot.	Resolution 1.88 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8AYZ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1EAH PV2L COMPLEXED WITH ANTIVIRAL AGENT SCH48973 Deposited 1997-07-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-MERIC	Chain 1 578–878（301 aa） Chain 2 69–339（271 aa） Chain 3 340–577（238 aa） Chain 4 1–68（68 aa）	Not recorded	SC4 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 60 MYR MYRISTIC ACID × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1EAH PV2L COMPLEXED WITH ANTIVIRAL AGENT SCH48973 Deposited 1997-07-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 578–878（301 aa） Chain 2 69–339（271 aa） Chain 3 340–577（238 aa） Chain 4 1–68（68 aa）	Not recorded	SC4 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1EAH PV2L COMPLEXED WITH ANTIVIRAL AGENT SCH48973 Deposited 1997-07-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain 1 578–878（301 aa） Chain 2 69–339（271 aa） Chain 3 340–577（238 aa） Chain 4 1–68（68 aa）	Not recorded	SC4 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 5 MYR MYRISTIC ACID × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1EAH PV2L COMPLEXED WITH ANTIVIRAL AGENT SCH48973 Deposited 1997-07-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain 1 578–878（301 aa） Chain 2 69–339（271 aa） Chain 3 340–577（238 aa） Chain 4 1–68（68 aa）	Not recorded	SC4 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 6 MYR MYRISTIC ACID × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1EAH PV2L COMPLEXED WITH ANTIVIRAL AGENT SCH48973 Deposited 1997-07-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 578–878（301 aa） Chain 2 69–339（271 aa） Chain 3 340–577（238 aa） Chain 4 1–68（68 aa）	Not recorded	SC4 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1EAH PV2L COMPLEXED WITH ANTIVIRAL AGENT SCH48973 Deposited 1997-07-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 120 PDB declaration: 120-meric	Chain 1 578–878（301 aa） Chain 2 69–339（271 aa） Chain 3 340–577（238 aa） Chain 4 1–68（68 aa）	Not recorded	SC4 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 30 MYR MYRISTIC ACID × 30	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
3EPF CryoEM structure of poliovirus receptor bound to poliovirus type 2 Deposited 2008-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: 300-MERIC	Chain 1 602–879（278 aa） Chain 2 79–340（262 aa） Chain 3 341–575（235 aa） Chain 4 2–69（68 aa）	Not recorded	SC4 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 60 MYR MYRISTIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
3EPF CryoEM structure of poliovirus receptor bound to poliovirus type 2 Deposited 2008-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 1 602–879（278 aa） Chain 2 79–340（262 aa） Chain 3 341–575（235 aa） Chain 4 2–69（68 aa）	Not recorded	SC4 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 1 MYR MYRISTIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
3EPF CryoEM structure of poliovirus receptor bound to poliovirus type 2 Deposited 2008-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain 1 602–879（278 aa） Chain 2 79–340（262 aa） Chain 3 341–575（235 aa） Chain 4 2–69（68 aa）	Not recorded	SC4 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 5 MYR MYRISTIC ACID × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
3EPF CryoEM structure of poliovirus receptor bound to poliovirus type 2 Deposited 2008-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain 1 602–879（278 aa） Chain 2 79–340（262 aa） Chain 3 341–575（235 aa） Chain 4 2–69（68 aa）	Not recorded	SC4 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 6 MYR MYRISTIC ACID × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
3EPF CryoEM structure of poliovirus receptor bound to poliovirus type 2 Deposited 2008-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 1 602–879（278 aa） Chain 2 79–340（262 aa） Chain 3 341–575（235 aa） Chain 4 2–69（68 aa）	Not recorded	SC4 1[2-CHLORO-4-METHOXY-PHENYL-OXYMETHYL]-4-[2,6-DICHLORO-PHENYL-OXYMETHYL]-BENZENE × 1 MYR MYRISTIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；10mM Tris-HCl, 20mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
9F59 Poliovirus type 2 (strain MEF-1) stabilised virus-like particle (PV2 SC6b) from a mammalian expression system. Deposited 2024-04-28	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 180 PDB declaration: 180-meric	Chain A 579–879（301 aa） Chain B 2–340（339 aa） Chain C 341–578（238 aa）	Mutation：VP1 V107I, VP1 F134L, VP1 V183L Mutation：VP2 I57V, VP2 D126A Mutation：VP3 Q178L	SPH SPHINGOSINE × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7；1 x DPBS, 20 mM EDTA, pH 7.0 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；4 ul of sample blotted for 3.5 seconds with -15 blot force on FEI Vitrobot mark IV.	Resolution 2.30 Å
9F5P Poliovirus type 2 (strain MEF-1) stabilised virus-like particle (PV2 SC6b) from an insect cell expression system. Deposited 2024-04-29	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 180 PDB declaration: 180-meric	Chain A 579–879（301 aa） Chain B 2–340（339 aa） Chain C 341–578（238 aa）	Mutation：VP1 V107I, VP1 V134L, VP1 V183L Mutation：VP2 I57V, VP2 D126A Mutation：VP3 Q178L	SPH SPHINGOSINE × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7；1 x DPBS, 20 mM EDTA, pH 7.0 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；4 ul of sample blotted for 3.5 seconds with -15 blot force on FEI Vitrobot mark IV.	Resolution 2.60 Å
9H93 Poliovirus type 2 (strain MEF-1) stabilised virus-like particle (PV2 SC6b) from a yeast expression system. Deposited 2024-10-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 180 PDB declaration: 180-meric	Chain B 1–340（340 aa）	Mutation：VP4 I57V, VP2 D57A	SPH SPHINGOSINE × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7；1 x DPBS, 20 mM EDTA, pH 7.0 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；3ul of sample double blotted for 3.5 seconds with -15 blot force on FEI Vitrobot mark IV.	Resolution 2.40 Å
9H94 Poliovirus type 2 (strain MEF-1) stabilised virus-like particle (PV2 SC5a) from a yeast expression system. Deposited 2024-10-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 180 PDB declaration: 180-meric	Chain B 1–340（340 aa）	Not recorded	SPH SPHINGOSINE × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7；1 x DPBS, 20 mM EDTA, pH 7.0 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；3ul of sample double blotted for 3.5 seconds with -15 blot force on FEI Vitrobot mark IV.	Resolution 2.10 Å
9OCL PV2-10D2 Complex Deposited 2025-04-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 360 PDB declaration: 360-meric	Chain 1 579–879（301 aa） Chain 2 70–340（271 aa）	Not recorded	PLM PALMITIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.65 Å
9OCL PV2-10D2 Complex Deposited 2025-04-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain 1 579–879（301 aa） Chain 2 70–340（271 aa）	Not recorded	PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.65 Å
9OCL PV2-10D2 Complex Deposited 2025-04-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain 1 579–879（301 aa） Chain 2 70–340（271 aa）	Not recorded	PLM PALMITIC ACID × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.65 Å
9OCL PV2-10D2 Complex Deposited 2025-04-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain 1 579–879（301 aa） Chain 2 70–340（271 aa）	Not recorded	PLM PALMITIC ACID × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.65 Å
9OCL PV2-10D2 Complex Deposited 2025-04-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain 1 579–879（301 aa） Chain 2 70–340（271 aa）	Not recorded	PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.65 Å

7 other PDB entries and 20 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	POLG_POL2L
Isoform	—
PDB entities	1, 2, 3
Chains and sequence ranges	Author chain A； PDBConstruct 1–301； UniProt 579–879 Author chain B； PDBConstruct 1–340； UniProt 1–340 Author chain C； PDBConstruct 2–238； UniProt 342–578

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8ayz
Deposition date deposition_date	2022-09-04
Structure title title	Poliovirus type 2 (strain MEF-1) virus-like particle in complex with capsid binder compound 17
Keywords keywords	Capsid protein, VIRUS LIKE PARTICLE, inhibitor, complex; VIRUS LIKE PARTICLE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	29.65 Å
Radius of gyration Rg (electron density) rg_electron	28.66 Å
Forward intensity I(0) i0	128357000.00
Molecular weight molecular_weight	89524.0 kDa
Excluded volume excluded_volume	111870 Å³
Envelope volume envelope_volume	137030 Å³
Hydration-shell volume shell_volume	39000 Å³
Envelope diameter envelope_diameter	101.6 Å
Shell Rg shell_rg	36.56 Å
Envelope Rg envelope_rg	29.30 Å
Shape Rg shape_rg	28.65 Å
Total Rg total_rg	29.42 Å
Total atoms total_atoms	6303
Residues n_residues	802
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	94.8 Å
Rg (real space) rg_real	29.58 Å
Rg uncertainty (real space) rg_real_error	0.58 Å
I(0) (real space) i0_real	1.2840e+08
I(0) uncertainty (real space) i0_real_error	1.7630e+06
Rg (reciprocal space) rg_reciprocal	29.61 Å
I(0) (reciprocal space) i0_reciprocal	128400000.0000
Solution quality estimate total_estimate	0.8921
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	35.8 Å
Skewness Skewness skewness	0.300
Kurtosis Kurtosis kurtosis	-0.337
Angular range angular_range	— – 0.2650 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	24150000.0000
Real-space data points n_real_points	54
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.905; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.999; Smooth: 0.878

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Capsid protein, VP1
Molecular weight formula_weight	33111.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	6565

GLGDLIEGVVEGVTRNALTPLTPANNLPDTQSSGPAHSKETPALTAVETGATNPLVPSDTVQTRHVIQKRTRSESTVESFFARGACVAIIEVDNDAPTKRASKLFSVWKITYKDTVQLRRKLEFFTYSRFDMEFTFVVTSNYTDANNGHALNQVYQIMYIPPGAPIPGKWNDYTWQTSSNPSVFYTYGAPPARISVPYVGIANAYSHFYDGFAKVPLAGQASTEGDSLYGAASLNDFGSLAVRVVNDHNPTKLTSKIRVYMKPKHVRVWCPRPPRAVPYYGPGVDYKDGLAPLPEKGLTTY

来源 Source

来源生物 organism	Human poliovirus 2
NCBI Class编号 ncbi_taxonomy_id	12083
宿主生物 host_organism	Mesocricetus auratus

Entity 2 Entity 2 polymer

Description description	Capsid protein, VP0
Molecular weight formula_weight	37456.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MGAQVSSQKVGAHENSNRAYGGSTINYTTINYYRDSASNAASKQDFAQDPSKFTEPIKDVLIKTAPTLNSPNIEACGYSDRVMQLTLGNSTITTQEAANSVVAYGRWPEYIKDSEANPVDQPTEPDVAACRFYTLDTVTWRKESRGWWWKLPDALKDMGLFGQNMFYHYLGRAGYTVHVQCNASKFHQGALGVFAVPEMCLAGDSTTHMFTKYENANPGEKGGEFKGSFTLDTNATNPARNFCPVDYLFGSGVLAGNAFVYPHQIINLRTNNCATLVLPYVNSLSIDSMTKHNNWGIAILPLAPLDFATESSTEIPITLTIAPMCCEFNGLRNITVPRTQ

来源 Source

来源生物 organism	Human poliovirus 2
NCBI Class编号 ncbi_taxonomy_id	12083
宿主生物 host_organism	Mesocricetus auratus

Entity 3 Entity 3 polymer

Description description	Capsid protein, VP3
Molecular weight formula_weight	26472.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

GLPVLNTPGSNQYLTADNYQSPCAIPEFDVTPPIDIPGEVRNMMELAEIDTMIPLNLTNQRKNTMDMYRVELNDAAHSDTPILCLSLSPASDPRLAHTMLGEILNYYTHWAGSLKFTFLFCGSMMATGKLLVSYAPPGAEAPKSRKEAMLGTHVIWDIGLQSSCTMVVPWISNTTYRQTINDSFTEGGYISMFYQTRVVVPLSTPRKMDILGFVSACNDFSVRLLRDTTHISQEAMPQ

来源 Source

来源生物 organism	Human poliovirus 2
NCBI Class编号 ncbi_taxonomy_id	12083
宿主生物 host_organism	Mesocricetus auratus

Entity 4 Entity 4 non-polymer

Description description	SPHINGOSINE
Molecular weight formula_weight	299.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 non-polymer

Description description	4-[[4-[1,3-bis(oxidanylidene)isoindol-2-yl]phenyl]sulfonylamino]benzoic acid
Molecular weight formula_weight	422.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	262

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	1.88 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	51518

fit	/app/data/saxs_computation/ay/8ayz/8ayz.fit
pddf	/app/data/pr_computation/ay/8ayz/8ayz.pr.out
profile	/app/data/saxs_computation/ay/8ayz/8ayz.dat

Poliovirus type 2 (strain MEF-1) virus-like particle in complex with capsid binder compound 17

1. Protein Identity and Related Structures Protein Identity & Related Structures

Capsid protein, VP1

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)