7zfm

Engineered Protein Targeting the Zika Viral Envelope Fusion Loop

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Peptidyl-prolyl cis-trans isomerase A

Escherichia coli K-12

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	1,2-ETHANEDIOL × 9 HEXAETHYLENE GLYCOL × 1 TRIETHYLENE GLYCOL × 1 ACETIC ACID × 3 SUCCINIC ACID × 1 water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	1,2-ETHANEDIOL × 8 TRIETHYLENE GLYCOL × 1 SUCCINIC ACID × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PPIA_ECOLI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 22–184； UniProt 25–187 Author chain B； PDBConstruct 22–184； UniProt 25–187

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7zfm
Deposition date deposition_date	2022-04-01
Structure title title	Engineered Protein Targeting the Zika Viral Envelope Fusion Loop
Keywords keywords	ZIKV, Neutralization, E protein, Fusion Loop, ANTIVIRAL PROTEIN; ANTIVIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7zfm__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7zfm__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7zfm__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	16.35 Å
Rg (electron density)	15.06 Å
Total Rg	16.29 Å
Atom count	2560
Residues	165
Excluded volume	23870 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7zfm__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`7zfm__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Peptidyl-prolyl cis-trans isomerase A
Molecular weight formula_weight	20675.0 kDa
EC 编号 ec_number	5.2.1.8
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	5572

MGSSHHHHHHSSGLVPRGSHMAKGDPHVLLTTSAGNIELELDSQKAPVSVQNFLDYVNNGFYNNTTFHSVIPGYMIQGGGYTEDMQQKQPNPPIKNEADNGLRNTRGTIAMMRTEDKDSATSQFFINVADNAYADHGQTRYGFAVFGKVVKGMDVADKISQVPTHDVGPYQSVPSKPVVILSATVLPGSGC

Source Source

Source organism organism	Escherichia coli K-12
NCBI taxonomy ID ncbi_taxonomy_id	83333
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	nat
Copy count entity_count	17

Entity 3 Entity 3 non-polymer

Description description	HEXAETHYLENE GLYCOL
Molecular weight formula_weight	282.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	TRIETHYLENE GLYCOL
Molecular weight formula_weight	150.2 kDa
Source method src_method	nat
Copy count entity_count	2

Entity 5 Entity 5 non-polymer

Description description	ACETIC ACID
Molecular weight formula_weight	60.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 6 Entity 6 non-polymer

Description description	SUCCINIC ACID
Molecular weight formula_weight	118.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 7 Entity 7 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	291

▶

7. Citations (8)

In Vitro Neutralisation of Zika Virus by an Engineered Protein Targeting the Viral Envelope Fusion Loop

SSRN (2022)

DOI: 10.2139/ssrn.4141045 PRIMARY

Macromolecular structure determination using X-rays, neutrons and electrons: recent developments in Phenix.

Acta Crystallogr D Struct Biol (2019)

PMID: 31588918 · DOI: 10.1107/S2059798319011471

How good are my data and what is the resolution?

Acta Crystallogr.,Sect.D (2013)

PMID: 23793146 · DOI: 10.1107/S0907444913000061

Towards automated crystallographic structure refinement with phenix.refine.

Acta Crystallogr.,Sect.D (2012)

PMID: 22505256 · DOI: 10.1107/S0907444912001308

Data processing and analysis with the autoPROC toolbox.

Acta Crystallogr.,Sect.D (2011)

PMID: 21460447 · DOI: 10.1107/S0907444911007773

Overview of the CCP4 suite and current developments.

Acta Crystallogr.,Sect.D (2011)

PMID: 21460441 · DOI: 10.1107/S0907444910045749

XDS.

Acta Crystallogr.,Sect.D (2010)

PMID: 20124692 · DOI: 10.1107/S0907444909047337

Scaling and assessment of data quality.

Acta Crystallogr.,Sect.D (2006)

PMID: 16369096 · DOI: 10.1107/S0907444905036693

Unit-cell length a length_a	81.618 Å
Unit-cell length b length_b	81.618 Å
Unit-cell length c length_c	113.282 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 43 21 2
Space-group number int_tables_number	96
Crystal system crystal_system	tetragonal

Resolution resolution	1.711 Å
Low-resolution limit resolution_low	66.220 Å
R factor r_factor	0.1900
R_work r_work	0.1885
R_free r_free	0.2206

Engineered Protein Targeting the Zika Viral Envelope Fusion Loop

1. Protein Identity and Related Structures Protein Identity & Related Structures

Peptidyl-prolyl cis-trans isomerase A

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7zfm__assembly_1__model_1

7zfm__assembly_1__model_1 | I(q)

7zfm__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

7. Citations (8)

Engineered Protein Targeting the Zika Viral Envelope Fusion Loop

1. Protein Identity and Related Structures Protein Identity & Related Structures

Peptidyl-prolyl cis-trans isomerase A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7zfm__assembly_1__model_1

7zfm__assembly_1__model_1 | I(q)

7zfm__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

7. Citations (8)