SAXSdb — 7zrd

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Potassium-transporting ATPase potassium-binding subunit

Escherichia coli

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain A； UniProt 1–557	Not recorded	Potassium-transporting ATPase KdpC subunit × 1 （P03961） Potassium-transporting ATPase KdpF subunit × 1 （P36937） Potassium-transporting ATPase ATP-binding subunit × 1 （P03960） K POTASSIUM ION × 9 CDL CARDIOLIPIN × 2 VO4 VANADATE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.30 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7ZRD	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5MRW Structure of the KdpFABC complex Deposited 2016-12-27	Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–557（557 aa）	Mutation：Q116R	K POTASSIUM ION × 1 PX4 1,2-DIMYRISTOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 BOG octyl beta-D-glucopyranoside × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；291 K；20% (w/v) PEG3350, 0.5-1.0 M NaCl, 0.05 mM sodium citrate pH 5.5.	Resolution 2.90 Å R-free 0.275
5MRW Structure of the KdpFABC complex Deposited 2016-12-27	Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 1–557（557 aa）	Mutation：Q116R	K POTASSIUM ION × 1 PX4 1,2-DIMYRISTOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 BOG octyl beta-D-glucopyranoside × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；291 K；20% (w/v) PEG3350, 0.5-1.0 M NaCl, 0.05 mM sodium citrate pH 5.5.	Resolution 2.90 Å R-free 0.275
5MRW Structure of the KdpFABC complex Deposited 2016-12-27	Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain I 1–557（557 aa）	Mutation：Q116R	K POTASSIUM ION × 1 PX4 1,2-DIMYRISTOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 BOG octyl beta-D-glucopyranoside × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；291 K；20% (w/v) PEG3350, 0.5-1.0 M NaCl, 0.05 mM sodium citrate pH 5.5.	Resolution 2.90 Å R-free 0.275
6HRA Cryo-EM structure of the KdpFABC complex in an E1 outward-facing state (state 1) Deposited 2018-09-26	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–557（557 aa）	Not recorded	K POTASSIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.012% DDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
6HRB Cryo-EM structure of the KdpFABC complex in an E2 inward-facing state (state 2) Deposited 2018-09-26	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–557（557 aa）	Not recorded	K POTASSIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.012% DDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
7BGY Cryo-EM Structure of KdpFABC in E2Pi state with MgF4 Deposited 2021-01-09	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–557（557 aa）	Mutation：Q116R	PEV (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 1 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 1 MG MAGNESIUM ION × 1 MF4 TETRAFLUOROMAGNESATE(2-) × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；A 10x stock solution of MgF4 was added to the protein mixture containing all other buffer components to produce final concentrations 1 mM MgCl2 and 10 mM NaF. cryo-EM vitrification conditions Cryogen ETHANE；3 uL of protein mixture applied to grid. Blot time 4 seconds, blot force 0, no wait before plunging.	Resolution 2.90 Å
7BH1 Cryo-EM Structure of KdpFABC in E1 state with K Deposited 2021-01-09	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–557（557 aa）	Mutation：Q116R	K POTASSIUM ION × 1 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL of protein mixture applied to grid. Blot time 4 seconds, blot force 0, no wait before plunging.	Resolution 3.38 Å
7BH2 Cryo-EM Structure of KdpFABC in E2Pi state with BeF3 and K+ Deposited 2021-01-09	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–557（557 aa）	Mutation：Q116R	K POTASSIUM ION × 2 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 1 MG MAGNESIUM ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；The beryllium fluoride in the buffer was added to the protein mixture containing all other buffer components in the form of a pre-incubated mixture, at a 1:10 volume, to produce the final concentrations 2.5 mM BeSO4 and 10 mM NaF. cryo-EM vitrification conditions Cryogen ETHANE；3 uL of protein mixture applied to grid. Blot time 4 seconds, blot force 0, no wait before plunging.	Resolution 3.00 Å
7LC3 CryoEM Structure of KdpFABC in E1-ATP state Deposited 2021-01-09	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–557（557 aa）	Mutation：Q116R	K POTASSIUM ION × 2 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 1 MG MAGNESIUM ION × 1 ACP PHOSPHOMETHYLPHOSPHONIC ACID ADENYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；AMPPCP was added to the protein after size-exclusion chromatography and incubated 1 hr prior to freezing cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.23 Å
7LC6 Cryo-EM Structure of KdpFABC in E2-P state with BeF3 Deposited 2021-01-09	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–557（557 aa）	Mutation：Q116R	K POTASSIUM ION × 1 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；The beryllium fluoride in the buffer was added to the protein mixture containing all other buffer components in the form of a pre-incubated mixture with the final concentrations 2.5 mM BeSO4 and 10 mM NaF. cryo-EM vitrification conditions Cryogen ETHANE；3 uL of protein mixture applied to grid. Blot time 4 seconds, blot force 0, no wait before plunging.	Resolution 3.70 Å
7ZRE Cryo-EM map of the WT KdpFABC complex in the E1-P tight conformation, under turnover conditions Deposited 2022-05-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–557（557 aa）	Not recorded	K POTASSIUM ION × 9 CDL CARDIOLIPIN × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7ZRG Cryo-EM map of the WT KdpFABC complex in the E1_ATPearly conformation, under turnover conditions Deposited 2022-05-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–557（557 aa）	Not recorded	K POTASSIUM ION × 7 CDL CARDIOLIPIN × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7ZRH Cryo-EM structure of the KdpFABC complex in a nucleotide-free E1 conformation loaded with K+ Deposited 2022-05-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–557（557 aa）	Not recorded	K POTASSIUM ION × 7 CDL CARDIOLIPIN × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7ZRI Cryo-EM structure of the KdpFABC complex in a nucleotide-free E1 conformation loaded with K+ Deposited 2022-05-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–557（557 aa）	Not recorded	K POTASSIUM ION × 7 CDL CARDIOLIPIN × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7ZRJ Cryo-EM structure of the KdpFABC complex in a nucleotide-free E1 conformation loaded with K+ Deposited 2022-05-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–557（557 aa）	Not recorded	K POTASSIUM ION × 7 CDL CARDIOLIPIN × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.70 Å
7ZRK Cryo-EM map of the WT KdpFABC complex in the E1-P_ADP conformation, under turnover conditions Deposited 2022-05-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–557（557 aa）	Not recorded	K POTASSIUM ION × 12 CDL CARDIOLIPIN × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.10 Å
7ZRL Cryo-EM map of the unphosphorylated KdpFABC complex in the E2-P conformation, under turnover conditions Deposited 2022-05-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–557（557 aa）	Not recorded	K POTASSIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.00 Å
7ZRM Cryo-EM map of the unphosphorylated KdpFABC complex in the E1-P_ADP conformation, under turnover conditions Deposited 2022-05-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–557（557 aa）	Not recorded	K POTASSIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.70 Å
9OC4 High-resolution cryo-EM structure of KdpFABC in the E1P-ADP state in lipid nanodisc Deposited 2025-04-23	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–557（557 aa）	Not recorded	K POTASSIUM ION × 2 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20 mM Tris pH 7.4, 100 mM KCl, and 0.5 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.10 Å
9ZWK High-resolution cryo-EM structure of KdpFABC in the E1 state in lipid nanodisc Deposited 2026-01-03	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–557（557 aa）	Not recorded	K POTASSIUM ION × 3 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20 mM Tris pH 7.4, 100 mM KCl, and 0.5 mM TCEP, 2 mM MgCl2, 1 mM ATP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.34 Å
9ZWL High-resolution cryo-EM structure of KdpFABC in the E1-ATP state in lipid nanodisc Deposited 2026-01-03	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–557（557 aa）	Not recorded	K POTASSIUM ION × 3 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20 mM Tris pH 7.4, 100 mM KCl, and 0.5 mM TCEP, 2mM MgCl2, 1mM ATP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.28 Å
9ZWM High-resolution cryo-EM structure of KdpFABC in the E1P state in lipid nanodisc Deposited 2026-01-03	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–557（557 aa）	Not recorded	K POTASSIUM ION × 3 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 2 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20 mM Tris pH 7.4, 100 mM KCl, and 0.5 mM TCEP, 2 mM MgCl2, 1 mM ATP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.25 Å
9ZWN High-resolution cryo-EM structure of KdpFABC in the E2P state in lipid nanodisc Deposited 2026-01-03	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–557（557 aa）	Not recorded	K POTASSIUM ION × 3 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20 mM Tris pH 7.4, 100 mM KCl, and 0.5 mM TCEP, 2 mM MgCl2, 1 mM ATP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.58 Å
9ZWO High-resolution cryo-EM structure of KdpFABC in the E2 state in lipid nanodisc Deposited 2026-01-03	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–557（557 aa）	Not recorded	K POTASSIUM ION × 2 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20 mM Tris pH 7.4, 100 mM KCl, and 0.5 mM TCEP, 2 mM MgCl2, 1 mM ATP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.72 Å

22 other PDB entries and 24 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	KDPA_ECOLI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–557； UniProt 1–557

Potassium-transporting ATPase KdpC subunit

Escherichia coli

UniProt P03961

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain C； UniProt 1–190	Not recorded	Potassium-transporting ATPase potassium-binding subunit × 1 （P03959） Potassium-transporting ATPase KdpF subunit × 1 （P36937） Potassium-transporting ATPase ATP-binding subunit × 1 （P03960） K POTASSIUM ION × 9 CDL CARDIOLIPIN × 2 VO4 VANADATE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.30 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7ZRD	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6HRA Cryo-EM structure of the KdpFABC complex in an E1 outward-facing state (state 1) Deposited 2018-09-26	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–190（190 aa）	Not recorded	K POTASSIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.012% DDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
6HRB Cryo-EM structure of the KdpFABC complex in an E2 inward-facing state (state 2) Deposited 2018-09-26	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–190（190 aa）	Not recorded	K POTASSIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.012% DDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
7BGY Cryo-EM Structure of KdpFABC in E2Pi state with MgF4 Deposited 2021-01-09	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–190（190 aa）	Not recorded	PEV (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 1 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 1 MG MAGNESIUM ION × 1 MF4 TETRAFLUOROMAGNESATE(2-) × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；A 10x stock solution of MgF4 was added to the protein mixture containing all other buffer components to produce final concentrations 1 mM MgCl2 and 10 mM NaF. cryo-EM vitrification conditions Cryogen ETHANE；3 uL of protein mixture applied to grid. Blot time 4 seconds, blot force 0, no wait before plunging.	Resolution 2.90 Å
7BH1 Cryo-EM Structure of KdpFABC in E1 state with K Deposited 2021-01-09	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–190（190 aa）	Not recorded	K POTASSIUM ION × 1 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL of protein mixture applied to grid. Blot time 4 seconds, blot force 0, no wait before plunging.	Resolution 3.38 Å
7BH2 Cryo-EM Structure of KdpFABC in E2Pi state with BeF3 and K+ Deposited 2021-01-09	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–190（190 aa）	Not recorded	K POTASSIUM ION × 2 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 1 MG MAGNESIUM ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；The beryllium fluoride in the buffer was added to the protein mixture containing all other buffer components in the form of a pre-incubated mixture, at a 1:10 volume, to produce the final concentrations 2.5 mM BeSO4 and 10 mM NaF. cryo-EM vitrification conditions Cryogen ETHANE；3 uL of protein mixture applied to grid. Blot time 4 seconds, blot force 0, no wait before plunging.	Resolution 3.00 Å
7LC3 CryoEM Structure of KdpFABC in E1-ATP state Deposited 2021-01-09	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–190（190 aa）	Not recorded	K POTASSIUM ION × 2 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 1 MG MAGNESIUM ION × 1 ACP PHOSPHOMETHYLPHOSPHONIC ACID ADENYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；AMPPCP was added to the protein after size-exclusion chromatography and incubated 1 hr prior to freezing cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.23 Å
7LC6 Cryo-EM Structure of KdpFABC in E2-P state with BeF3 Deposited 2021-01-09	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–190（190 aa）	Not recorded	K POTASSIUM ION × 1 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；The beryllium fluoride in the buffer was added to the protein mixture containing all other buffer components in the form of a pre-incubated mixture with the final concentrations 2.5 mM BeSO4 and 10 mM NaF. cryo-EM vitrification conditions Cryogen ETHANE；3 uL of protein mixture applied to grid. Blot time 4 seconds, blot force 0, no wait before plunging.	Resolution 3.70 Å
7ZRE Cryo-EM map of the WT KdpFABC complex in the E1-P tight conformation, under turnover conditions Deposited 2022-05-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–190（190 aa）	Not recorded	K POTASSIUM ION × 9 CDL CARDIOLIPIN × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7ZRG Cryo-EM map of the WT KdpFABC complex in the E1_ATPearly conformation, under turnover conditions Deposited 2022-05-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–190（190 aa）	Not recorded	K POTASSIUM ION × 7 CDL CARDIOLIPIN × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7ZRH Cryo-EM structure of the KdpFABC complex in a nucleotide-free E1 conformation loaded with K+ Deposited 2022-05-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–190（190 aa）	Not recorded	K POTASSIUM ION × 7 CDL CARDIOLIPIN × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7ZRI Cryo-EM structure of the KdpFABC complex in a nucleotide-free E1 conformation loaded with K+ Deposited 2022-05-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–190（190 aa）	Not recorded	K POTASSIUM ION × 7 CDL CARDIOLIPIN × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7ZRJ Cryo-EM structure of the KdpFABC complex in a nucleotide-free E1 conformation loaded with K+ Deposited 2022-05-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–190（190 aa）	Not recorded	K POTASSIUM ION × 7 CDL CARDIOLIPIN × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.70 Å
7ZRK Cryo-EM map of the WT KdpFABC complex in the E1-P_ADP conformation, under turnover conditions Deposited 2022-05-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–190（190 aa）	Not recorded	K POTASSIUM ION × 12 CDL CARDIOLIPIN × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.10 Å
7ZRL Cryo-EM map of the unphosphorylated KdpFABC complex in the E2-P conformation, under turnover conditions Deposited 2022-05-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–190（190 aa）	Not recorded	K POTASSIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.00 Å
7ZRM Cryo-EM map of the unphosphorylated KdpFABC complex in the E1-P_ADP conformation, under turnover conditions Deposited 2022-05-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–190（190 aa）	Not recorded	K POTASSIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.70 Å
9OC4 High-resolution cryo-EM structure of KdpFABC in the E1P-ADP state in lipid nanodisc Deposited 2025-04-23	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–190（190 aa）	Not recorded	K POTASSIUM ION × 2 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20 mM Tris pH 7.4, 100 mM KCl, and 0.5 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.10 Å
9ZWK High-resolution cryo-EM structure of KdpFABC in the E1 state in lipid nanodisc Deposited 2026-01-03	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–190（190 aa）	Not recorded	K POTASSIUM ION × 3 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20 mM Tris pH 7.4, 100 mM KCl, and 0.5 mM TCEP, 2 mM MgCl2, 1 mM ATP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.34 Å
9ZWL High-resolution cryo-EM structure of KdpFABC in the E1-ATP state in lipid nanodisc Deposited 2026-01-03	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–190（190 aa）	Not recorded	K POTASSIUM ION × 3 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20 mM Tris pH 7.4, 100 mM KCl, and 0.5 mM TCEP, 2mM MgCl2, 1mM ATP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.28 Å
9ZWM High-resolution cryo-EM structure of KdpFABC in the E1P state in lipid nanodisc Deposited 2026-01-03	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–190（190 aa）	Not recorded	K POTASSIUM ION × 3 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 2 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20 mM Tris pH 7.4, 100 mM KCl, and 0.5 mM TCEP, 2 mM MgCl2, 1 mM ATP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.25 Å
9ZWN High-resolution cryo-EM structure of KdpFABC in the E2P state in lipid nanodisc Deposited 2026-01-03	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–190（190 aa）	Not recorded	K POTASSIUM ION × 3 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20 mM Tris pH 7.4, 100 mM KCl, and 0.5 mM TCEP, 2 mM MgCl2, 1 mM ATP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.58 Å
9ZWO High-resolution cryo-EM structure of KdpFABC in the E2 state in lipid nanodisc Deposited 2026-01-03	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–190（190 aa）	Not recorded	K POTASSIUM ION × 2 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20 mM Tris pH 7.4, 100 mM KCl, and 0.5 mM TCEP, 2 mM MgCl2, 1 mM ATP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.72 Å

21 other PDB entries and 21 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	KDPC_ECOLI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–190； UniProt 1–190

Potassium-transporting ATPase KdpF subunit

Escherichia coli

UniProt P36937

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain D； UniProt 1–29	Not recorded	Potassium-transporting ATPase potassium-binding subunit × 1 （P03959） Potassium-transporting ATPase KdpC subunit × 1 （P03961） Potassium-transporting ATPase ATP-binding subunit × 1 （P03960） K POTASSIUM ION × 9 CDL CARDIOLIPIN × 2 VO4 VANADATE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.30 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7ZRD	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5MRW Structure of the KdpFABC complex Deposited 2016-12-27	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–27（27 aa）	Not recorded	K POTASSIUM ION × 1 PX4 1,2-DIMYRISTOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 BOG octyl beta-D-glucopyranoside × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；291 K；20% (w/v) PEG3350, 0.5-1.0 M NaCl, 0.05 mM sodium citrate pH 5.5.	Resolution 2.90 Å R-free 0.275
5MRW Structure of the KdpFABC complex Deposited 2016-12-27	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain H 1–27（27 aa）	Not recorded	K POTASSIUM ION × 1 PX4 1,2-DIMYRISTOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 BOG octyl beta-D-glucopyranoside × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；291 K；20% (w/v) PEG3350, 0.5-1.0 M NaCl, 0.05 mM sodium citrate pH 5.5.	Resolution 2.90 Å R-free 0.275
5MRW Structure of the KdpFABC complex Deposited 2016-12-27	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain L 1–27（27 aa）	Not recorded	K POTASSIUM ION × 1 PX4 1,2-DIMYRISTOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 BOG octyl beta-D-glucopyranoside × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；291 K；20% (w/v) PEG3350, 0.5-1.0 M NaCl, 0.05 mM sodium citrate pH 5.5.	Resolution 2.90 Å R-free 0.275
6HRA Cryo-EM structure of the KdpFABC complex in an E1 outward-facing state (state 1) Deposited 2018-09-26	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–29（29 aa）	Not recorded	K POTASSIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.012% DDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
6HRB Cryo-EM structure of the KdpFABC complex in an E2 inward-facing state (state 2) Deposited 2018-09-26	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–29（29 aa）	Not recorded	K POTASSIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.012% DDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
7BGY Cryo-EM Structure of KdpFABC in E2Pi state with MgF4 Deposited 2021-01-09	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–29（29 aa）	Not recorded	PEV (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 1 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 1 MG MAGNESIUM ION × 1 MF4 TETRAFLUOROMAGNESATE(2-) × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；A 10x stock solution of MgF4 was added to the protein mixture containing all other buffer components to produce final concentrations 1 mM MgCl2 and 10 mM NaF. cryo-EM vitrification conditions Cryogen ETHANE；3 uL of protein mixture applied to grid. Blot time 4 seconds, blot force 0, no wait before plunging.	Resolution 2.90 Å
7BH1 Cryo-EM Structure of KdpFABC in E1 state with K Deposited 2021-01-09	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–29（29 aa）	Not recorded	K POTASSIUM ION × 1 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL of protein mixture applied to grid. Blot time 4 seconds, blot force 0, no wait before plunging.	Resolution 3.38 Å
7BH2 Cryo-EM Structure of KdpFABC in E2Pi state with BeF3 and K+ Deposited 2021-01-09	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–29（29 aa）	Not recorded	K POTASSIUM ION × 2 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 1 MG MAGNESIUM ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；The beryllium fluoride in the buffer was added to the protein mixture containing all other buffer components in the form of a pre-incubated mixture, at a 1:10 volume, to produce the final concentrations 2.5 mM BeSO4 and 10 mM NaF. cryo-EM vitrification conditions Cryogen ETHANE；3 uL of protein mixture applied to grid. Blot time 4 seconds, blot force 0, no wait before plunging.	Resolution 3.00 Å
7LC3 CryoEM Structure of KdpFABC in E1-ATP state Deposited 2021-01-09	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–29（29 aa）	Not recorded	K POTASSIUM ION × 2 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 1 MG MAGNESIUM ION × 1 ACP PHOSPHOMETHYLPHOSPHONIC ACID ADENYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；AMPPCP was added to the protein after size-exclusion chromatography and incubated 1 hr prior to freezing cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.23 Å
7LC6 Cryo-EM Structure of KdpFABC in E2-P state with BeF3 Deposited 2021-01-09	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–29（29 aa）	Not recorded	K POTASSIUM ION × 1 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；The beryllium fluoride in the buffer was added to the protein mixture containing all other buffer components in the form of a pre-incubated mixture with the final concentrations 2.5 mM BeSO4 and 10 mM NaF. cryo-EM vitrification conditions Cryogen ETHANE；3 uL of protein mixture applied to grid. Blot time 4 seconds, blot force 0, no wait before plunging.	Resolution 3.70 Å
7NNL Cryo-EM structure of the KdpFABC complex in an E1-ATP conformation loaded with K+ Deposited 2021-02-25	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–27（27 aa）	Not recorded	K POTASSIUM ION × 10 CDL CARDIOLIPIN × 2 ACP PHOSPHOMETHYLPHOSPHONIC ACID ADENYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.10 Å
7NNP Rb-loaded cryo-EM structure of the E1-ATP KdpFABC complex. Deposited 2021-02-25	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–27（27 aa）	Not recorded	RB RUBIDIUM ION × 8 CDL CARDIOLIPIN × 2 ACP PHOSPHOMETHYLPHOSPHONIC ACID ADENYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7ZRE Cryo-EM map of the WT KdpFABC complex in the E1-P tight conformation, under turnover conditions Deposited 2022-05-04	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–27（27 aa）	Not recorded	K POTASSIUM ION × 9 CDL CARDIOLIPIN × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7ZRG Cryo-EM map of the WT KdpFABC complex in the E1_ATPearly conformation, under turnover conditions Deposited 2022-05-04	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–27（27 aa）	Not recorded	K POTASSIUM ION × 7 CDL CARDIOLIPIN × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7ZRH Cryo-EM structure of the KdpFABC complex in a nucleotide-free E1 conformation loaded with K+ Deposited 2022-05-04	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–27（27 aa）	Not recorded	K POTASSIUM ION × 7 CDL CARDIOLIPIN × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7ZRI Cryo-EM structure of the KdpFABC complex in a nucleotide-free E1 conformation loaded with K+ Deposited 2022-05-04	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–27（27 aa）	Not recorded	K POTASSIUM ION × 7 CDL CARDIOLIPIN × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7ZRJ Cryo-EM structure of the KdpFABC complex in a nucleotide-free E1 conformation loaded with K+ Deposited 2022-05-04	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–27（27 aa）	Not recorded	K POTASSIUM ION × 7 CDL CARDIOLIPIN × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.70 Å
7ZRK Cryo-EM map of the WT KdpFABC complex in the E1-P_ADP conformation, under turnover conditions Deposited 2022-05-04	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–27（27 aa）	Not recorded	K POTASSIUM ION × 12 CDL CARDIOLIPIN × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.10 Å
7ZRL Cryo-EM map of the unphosphorylated KdpFABC complex in the E2-P conformation, under turnover conditions Deposited 2022-05-04	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–27（27 aa）	Not recorded	K POTASSIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.00 Å
7ZRM Cryo-EM map of the unphosphorylated KdpFABC complex in the E1-P_ADP conformation, under turnover conditions Deposited 2022-05-04	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–27（27 aa）	Not recorded	K POTASSIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.70 Å
9OC4 High-resolution cryo-EM structure of KdpFABC in the E1P-ADP state in lipid nanodisc Deposited 2025-04-23	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–29（29 aa）	Not recorded	K POTASSIUM ION × 2 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20 mM Tris pH 7.4, 100 mM KCl, and 0.5 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.10 Å
9ZWK High-resolution cryo-EM structure of KdpFABC in the E1 state in lipid nanodisc Deposited 2026-01-03	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–29（29 aa）	Not recorded	K POTASSIUM ION × 3 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20 mM Tris pH 7.4, 100 mM KCl, and 0.5 mM TCEP, 2 mM MgCl2, 1 mM ATP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.34 Å
9ZWL High-resolution cryo-EM structure of KdpFABC in the E1-ATP state in lipid nanodisc Deposited 2026-01-03	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–29（29 aa）	Not recorded	K POTASSIUM ION × 3 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20 mM Tris pH 7.4, 100 mM KCl, and 0.5 mM TCEP, 2mM MgCl2, 1mM ATP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.28 Å
9ZWM High-resolution cryo-EM structure of KdpFABC in the E1P state in lipid nanodisc Deposited 2026-01-03	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–29（29 aa）	Not recorded	K POTASSIUM ION × 3 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 2 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20 mM Tris pH 7.4, 100 mM KCl, and 0.5 mM TCEP, 2 mM MgCl2, 1 mM ATP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.25 Å
9ZWN High-resolution cryo-EM structure of KdpFABC in the E2P state in lipid nanodisc Deposited 2026-01-03	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–29（29 aa）	Not recorded	K POTASSIUM ION × 3 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20 mM Tris pH 7.4, 100 mM KCl, and 0.5 mM TCEP, 2 mM MgCl2, 1 mM ATP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.58 Å
9ZWO High-resolution cryo-EM structure of KdpFABC in the E2 state in lipid nanodisc Deposited 2026-01-03	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–29（29 aa）	Not recorded	K POTASSIUM ION × 2 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20 mM Tris pH 7.4, 100 mM KCl, and 0.5 mM TCEP, 2 mM MgCl2, 1 mM ATP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.72 Å

24 other PDB entries and 26 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	KDPF_ECOLI
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–29； UniProt 1–29

Potassium-transporting ATPase ATP-binding subunit

Escherichia coli

UniProt P03960

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain B； UniProt 1–682	Non-standard monomer：Yes (specific site not provided by mmCIF)	Potassium-transporting ATPase potassium-binding subunit × 1 （P03959） Potassium-transporting ATPase KdpC subunit × 1 （P03961） Potassium-transporting ATPase KdpF subunit × 1 （P36937） K POTASSIUM ION × 9 CDL CARDIOLIPIN × 2 VO4 VANADATE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.30 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7ZRD	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1SVJ The solution structure of the nucleotide binding domain of KdpB Deposited 2004-03-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 316–451（136 aa） Fragment：N-terminal domain	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6；300 K；Ionic strength (raw mmCIF value) 100mM NACL；Pressure AMBIENT NMR sample composition 1.4MM KDPBN U-15N,13C, 50MM PHOSPHATE BUFFER, 100MM NACL, 0.05% SODIUM AZIDE; 1.2MM KDPBN U-15N, 50MM PHOSPHATE BUFFER, 100MM NACL, 0.05% SODIUM AZIDE	Resolution not provided
1U7Q THE SOLUTION STRUCTURE OF THE NUCLEOTIDE BINDING DOMAIN OF KDPB Deposited 2004-08-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 316–451（136 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6；300 K；Ionic strength (raw mmCIF value) 100mM NACL；Pressure AMBIENT NMR sample composition 1.4MM U-15N,13C KDPBN, 50MM PHOSPHATE BUFFER, 100MM NACL, 0.05% SODIUM AZIDE; 1.2MM U-15N KDPBN, 50MM PHOSPHATE BUFFER, 100MM NACL, 0.05% SODIUM AZIDE	Resolution not provided
2A00 The solution structure of the AMP-PNP bound nucleotide binding domain of KdpB Deposited 2005-06-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 316–451（136 aa） Fragment：KdpBN, nucleotide binding domain of KdpB	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1	SOLUTION NMR NMR measurement conditions pH 6；300 K；Ionic strength (raw mmCIF value) 100mM NACL；Pressure AMBIENT NMR sample composition 1.0MM U-15N,13C KDPBN, 50MM phosphate buffer, 100MM NACL, 0.05% sodium azide, 15MM ATP- PNP; 1.0MM U-15N KDPBN, 50MM phosphate buffer, 100MM NACL, 0.05% sodium azide, 15MM AMP- PNP	Resolution not provided
2A29 The solution structure of the AMP-PNP bound nucleotide binding domain of KdpB Deposited 2005-06-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 316–451（136 aa） Fragment：KdpBN, nucleotide binding domain of KdpB	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1	SOLUTION NMR NMR measurement conditions pH 6；300 K；Ionic strength (raw mmCIF value) 100mM NACL；Pressure AMBIENT NMR sample composition 1.0MM U-15N, 13C KDPBN, 50MM PHOSPHATE BUFFER, 100MM NACL, 0.05% SODIUM AZIDE, 15MM ATP- PNP; 1.0MM U-15N KDPBN, 50MM PHOSPHATE BUFFER, 100MM NACL, 0.05% SODIUM AZIDE, 15MM AMP- PNP	Resolution not provided
5MRW Structure of the KdpFABC complex Deposited 2016-12-27	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 9–682（674 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	K POTASSIUM ION × 1 PX4 1,2-DIMYRISTOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 BOG octyl beta-D-glucopyranoside × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；291 K；20% (w/v) PEG3350, 0.5-1.0 M NaCl, 0.05 mM sodium citrate pH 5.5.	Resolution 2.90 Å R-free 0.275
5MRW Structure of the KdpFABC complex Deposited 2016-12-27	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain F 9–682（674 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	K POTASSIUM ION × 1 PX4 1,2-DIMYRISTOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 BOG octyl beta-D-glucopyranoside × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；291 K；20% (w/v) PEG3350, 0.5-1.0 M NaCl, 0.05 mM sodium citrate pH 5.5.	Resolution 2.90 Å R-free 0.275
5MRW Structure of the KdpFABC complex Deposited 2016-12-27	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain J 9–682（674 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	K POTASSIUM ION × 1 PX4 1,2-DIMYRISTOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 BOG octyl beta-D-glucopyranoside × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；291 K；20% (w/v) PEG3350, 0.5-1.0 M NaCl, 0.05 mM sodium citrate pH 5.5.	Resolution 2.90 Å R-free 0.275
6HRA Cryo-EM structure of the KdpFABC complex in an E1 outward-facing state (state 1) Deposited 2018-09-26	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–682（682 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	K POTASSIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.012% DDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
6HRB Cryo-EM structure of the KdpFABC complex in an E2 inward-facing state (state 2) Deposited 2018-09-26	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–682（682 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	K POTASSIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.012% DDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
7BGY Cryo-EM Structure of KdpFABC in E2Pi state with MgF4 Deposited 2021-01-09	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–682（682 aa）	Mutation：S162A	PEV (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 1 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 1 MG MAGNESIUM ION × 1 MF4 TETRAFLUOROMAGNESATE(2-) × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；A 10x stock solution of MgF4 was added to the protein mixture containing all other buffer components to produce final concentrations 1 mM MgCl2 and 10 mM NaF. cryo-EM vitrification conditions Cryogen ETHANE；3 uL of protein mixture applied to grid. Blot time 4 seconds, blot force 0, no wait before plunging.	Resolution 2.90 Å
7BH1 Cryo-EM Structure of KdpFABC in E1 state with K Deposited 2021-01-09	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–682（682 aa）	Mutation：S162A	K POTASSIUM ION × 1 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL of protein mixture applied to grid. Blot time 4 seconds, blot force 0, no wait before plunging.	Resolution 3.38 Å
7BH2 Cryo-EM Structure of KdpFABC in E2Pi state with BeF3 and K+ Deposited 2021-01-09	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–682（682 aa）	Mutation：S162A	K POTASSIUM ION × 2 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 1 MG MAGNESIUM ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；The beryllium fluoride in the buffer was added to the protein mixture containing all other buffer components in the form of a pre-incubated mixture, at a 1:10 volume, to produce the final concentrations 2.5 mM BeSO4 and 10 mM NaF. cryo-EM vitrification conditions Cryogen ETHANE；3 uL of protein mixture applied to grid. Blot time 4 seconds, blot force 0, no wait before plunging.	Resolution 3.00 Å
7LC3 CryoEM Structure of KdpFABC in E1-ATP state Deposited 2021-01-09	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–682（682 aa）	Mutation：S162A	K POTASSIUM ION × 2 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 1 MG MAGNESIUM ION × 1 ACP PHOSPHOMETHYLPHOSPHONIC ACID ADENYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；AMPPCP was added to the protein after size-exclusion chromatography and incubated 1 hr prior to freezing cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.23 Å
7LC6 Cryo-EM Structure of KdpFABC in E2-P state with BeF3 Deposited 2021-01-09	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–682（682 aa）	Mutation：S162A	K POTASSIUM ION × 1 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；The beryllium fluoride in the buffer was added to the protein mixture containing all other buffer components in the form of a pre-incubated mixture with the final concentrations 2.5 mM BeSO4 and 10 mM NaF. cryo-EM vitrification conditions Cryogen ETHANE；3 uL of protein mixture applied to grid. Blot time 4 seconds, blot force 0, no wait before plunging.	Resolution 3.70 Å
7ZRE Cryo-EM map of the WT KdpFABC complex in the E1-P tight conformation, under turnover conditions Deposited 2022-05-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–682（682 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	K POTASSIUM ION × 9 CDL CARDIOLIPIN × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7ZRG Cryo-EM map of the WT KdpFABC complex in the E1_ATPearly conformation, under turnover conditions Deposited 2022-05-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–682（682 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	K POTASSIUM ION × 7 CDL CARDIOLIPIN × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7ZRH Cryo-EM structure of the KdpFABC complex in a nucleotide-free E1 conformation loaded with K+ Deposited 2022-05-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–682（682 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	K POTASSIUM ION × 7 CDL CARDIOLIPIN × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7ZRI Cryo-EM structure of the KdpFABC complex in a nucleotide-free E1 conformation loaded with K+ Deposited 2022-05-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–682（682 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	K POTASSIUM ION × 7 CDL CARDIOLIPIN × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7ZRJ Cryo-EM structure of the KdpFABC complex in a nucleotide-free E1 conformation loaded with K+ Deposited 2022-05-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–682（682 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	K POTASSIUM ION × 7 CDL CARDIOLIPIN × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.70 Å
7ZRK Cryo-EM map of the WT KdpFABC complex in the E1-P_ADP conformation, under turnover conditions Deposited 2022-05-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–682（682 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	K POTASSIUM ION × 12 CDL CARDIOLIPIN × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.10 Å
7ZRL Cryo-EM map of the unphosphorylated KdpFABC complex in the E2-P conformation, under turnover conditions Deposited 2022-05-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–682（682 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	K POTASSIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.00 Å
7ZRM Cryo-EM map of the unphosphorylated KdpFABC complex in the E1-P_ADP conformation, under turnover conditions Deposited 2022-05-04	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–682（682 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	K POTASSIUM ION × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl pH 8, 10 mM MgCl2, 10 mM NaCl and 0.0125% DDM cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.70 Å
9OC4 High-resolution cryo-EM structure of KdpFABC in the E1P-ADP state in lipid nanodisc Deposited 2025-04-23	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–682（682 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	K POTASSIUM ION × 2 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20 mM Tris pH 7.4, 100 mM KCl, and 0.5 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.10 Å
9ZWK High-resolution cryo-EM structure of KdpFABC in the E1 state in lipid nanodisc Deposited 2026-01-03	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–682（682 aa）	Not recorded	K POTASSIUM ION × 3 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20 mM Tris pH 7.4, 100 mM KCl, and 0.5 mM TCEP, 2 mM MgCl2, 1 mM ATP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.34 Å
9ZWL High-resolution cryo-EM structure of KdpFABC in the E1-ATP state in lipid nanodisc Deposited 2026-01-03	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–682（682 aa）	Not recorded	K POTASSIUM ION × 3 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20 mM Tris pH 7.4, 100 mM KCl, and 0.5 mM TCEP, 2mM MgCl2, 1mM ATP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.28 Å
9ZWM High-resolution cryo-EM structure of KdpFABC in the E1P state in lipid nanodisc Deposited 2026-01-03	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–682（682 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	K POTASSIUM ION × 3 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 2 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20 mM Tris pH 7.4, 100 mM KCl, and 0.5 mM TCEP, 2 mM MgCl2, 1 mM ATP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.25 Å
9ZWN High-resolution cryo-EM structure of KdpFABC in the E2P state in lipid nanodisc Deposited 2026-01-03	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–682（682 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	K POTASSIUM ION × 3 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20 mM Tris pH 7.4, 100 mM KCl, and 0.5 mM TCEP, 2 mM MgCl2, 1 mM ATP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.58 Å
9ZWO High-resolution cryo-EM structure of KdpFABC in the E2 state in lipid nanodisc Deposited 2026-01-03	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–682（682 aa）	Not recorded	K POTASSIUM ION × 2 9Y0 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20 mM Tris pH 7.4, 100 mM KCl, and 0.5 mM TCEP, 2 mM MgCl2, 1 mM ATP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.72 Å

26 other PDB entries and 28 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	KDPB_ECOLI
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain B； PDBConstruct 1–682； UniProt 1–682

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7zrd
Deposition date deposition_date	2022-05-04
Structure title title	Cryo-EM map of the WT KdpFABC complex in the E1-P tight conformation, stabilised with the inhibitor orthovanadate
Keywords keywords	P-type ATPase, superfamily of K+ transporters (SKT), potassium uptake system, off-cycle post-albers conformation, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	40.90 Å
Radius of gyration Rg (electron density) rg_electron	39.96 Å
Forward intensity I(0) i0	324046000.00
Molecular weight molecular_weight	157390.0 kDa
Excluded volume excluded_volume	201570 Å³
Envelope volume envelope_volume	246620 Å³
Hydration-shell volume shell_volume	53508 Å³
Envelope diameter envelope_diameter	148.3 Å
Shell Rg shell_rg	43.19 Å
Envelope Rg envelope_rg	40.59 Å
Shape Rg shape_rg	40.04 Å
Total Rg total_rg	39.86 Å
Total atoms total_atoms	11037
Residues n_residues	1451
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	140.2 Å
Rg (real space) rg_real	41.21 Å
Rg uncertainty (real space) rg_real_error	1.36 Å
I(0) (real space) i0_real	3.2400e+08
I(0) uncertainty (real space) i0_real_error	6.2310e+06
Rg (reciprocal space) rg_reciprocal	40.90 Å
I(0) (reciprocal space) i0_reciprocal	323900000.0000
Solution quality estimate total_estimate	0.8177
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	39.5 Å
Skewness Skewness skewness	0.564
Kurtosis Kurtosis kurtosis	-0.231
Angular range angular_range	— – 0.1950 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	55900000.0000
Real-space data points n_real_points	40
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.768; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.767; Smooth: 0.554

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Potassium-transporting ATPase potassium-binding subunit
Molecular weight formula_weight	59218.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	11037

MAAQGFLLIATFLLVLMVLARPLGSGLARLINDIPLPGTTGVERVLFRALGVSDREMNWKQYLCAILGLNMLGLAVLFFMLLGQHYLPLNPQQLPGLSWDLALNTAVSFVTNTNWQSYSGETTLSYFSQMAGLTVQNFLSAASGIAVIFALIRAFTRQSMSTLGNAWVDLLRITLWVLVPVALLIALFFIQQGALQNFLPYQAVNTVEGAQQLLPMGPVASQEAIKMLGTNGGGFFNANSSHPFENPTALTNFVQMLAIFLIPTALCFAFGEVMGDRRQGRMLLWAMSVIFVICVGVVMWAEVQGNPHLLALGTDSSINMEGKESRFGVLVSSLFAVVTTAASCGAVIAMHDSFTALGGMVPMWLMQIGEVVFGGVGSGLYGMMLFVLLAVFIAGLMIGRTPEYLGKKIDVREMKLTALAILVTPTLVLMGAALAMMTDAGRSAMLNPGPHGFSEVLYAVSSAANNNGSAFAGLSANSPFWNCLLAFCMFVGRFGVIIPVMAIAGSLVSKKSQAASSGTLPTHGPLFVGLLIGTVLLVGALTFIPALALGPVAEYLS

来源 Source

来源生物 organism	Escherichia coli
NCBI Class编号 ncbi_taxonomy_id	562
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Potassium-transporting ATPase KdpC subunit
Molecular weight formula_weight	20281.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSGLRPALSTFIFLLLITGGVYPLLTTVLGQWWFPWQANGSLIREGDTVRGSALIGQNFTGNGYFHGRPSATAEMPYNPQASGGSNLAVSNPELDKLIAARVAALRAANPDASASVPVELVTASASGLDNNITPQAAAWQIPRVAKARNLSVEQLTQLIAKYSQQPLVKYIGQPVVNIVELNLALDKLDE

来源 Source

来源生物 organism	Escherichia coli
NCBI Class编号 ncbi_taxonomy_id	562
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Potassium-transporting ATPase KdpF subunit
Molecular weight formula_weight	3071.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MSAGVITGVLLVFLLLGYLVYALINAEAF

来源 Source

来源生物 organism	Escherichia coli
NCBI Class编号 ncbi_taxonomy_id	562
宿主生物 host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	Potassium-transporting ATPase ATP-binding subunit
Molecular weight formula_weight	72347.8 kDa
EC 编号 ec_number	7.2.2.6
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSRKQLALFEPTLVVQALKEAVKKLNPQAQWRNPVMFIVWIGSLLTTCISIAMASGAMPGNALFSAAISGWLWITVLFANFAEALAEGRSKAQANSLKGVKKTAFARKLREPKYGAAADKVPADQLRKGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGGDFASVTGGTRILSDWLVIECSVNPGETFLDRMIAMVEGAQRRKTPNEIALTILLIALTIVFLLATATLWPFSAWGGNAVSVTVLVALLVCLIPTTIGGLLSAIGVAGMSRMLGANVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVDEKTLADAAQLASLADETPEGRSIVILAKQRFNLRERDVQSLHATFVPFTAQSRMSGINIDNRMIRKGSVDAIRRHVEANGGHFPTDVDQKVDQVARQGATPLVVVEGSRVLGVIALKDIVKGGIKERFAQLRKMGIKTVMITGDNRLTAAAIAAEAGVDDFLAEATPEAKLALIRQYQAEGRLVAMTGDGTNDAPALAQADVAVAMNSGTQAAKEAGNMVDLDSNPTKLIEVVHIGKQMLMTRGSLTTFSIANDVAKYFAIIPAAFAATYPQLNALNIMCLHSPDSAILSAVIFNALIIVFLIPLALKGVSYKPLTASAMLRRNLWIYGLGGLLVPFIGIKVIDLLLTVCGLV

来源 Source

来源生物 organism	Escherichia coli
NCBI Class编号 ncbi_taxonomy_id	562
宿主生物 host_organism	Escherichia coli

Entity 5 Entity 5 non-polymer

Description description	POTASSIUM ION
Molecular weight formula_weight	39.1 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 6 Entity 6 non-polymer

Description description	CARDIOLIPIN
Molecular weight formula_weight	1464.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 7 Entity 7 non-polymer

Description description	VANADATE ION
Molecular weight formula_weight	114.9 kDa
Source method src_method	syn
Copy count entity_count	1

▼

7. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	7zrdB01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1110 — Calcium-transporting ATPase, cytoplasmic domain N
Homologous superfamily homologous superfamily	10 — Calcium-transporting ATPase, cytoplasmic domain N

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.30 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	74927

fit	/app/data/saxs_computation/zr/7zrd/7zrd.fit
pddf	/app/data/pr_computation/zr/7zrd/7zrd.pr.out
profile	/app/data/saxs_computation/zr/7zrd/7zrd.dat

Cryo-EM map of the WT KdpFABC complex in the E1-P tight conformation, stabilised with the inhibitor orthovanadate

1. Protein Identity and Related Structures Protein Identity & Related Structures

Potassium-transporting ATPase potassium-binding subunit

State in the Current Structure

Other States of the Same Protein in the Database

Potassium-transporting ATPase KdpC subunit

State in the Current Structure

Other States of the Same Protein in the Database

Potassium-transporting ATPase KdpF subunit

State in the Current Structure

Other States of the Same Protein in the Database

Potassium-transporting ATPase ATP-binding subunit

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 polymer

Polymer Polymer

来源 Source

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

7. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)