5mrw

Structure of the KdpFABC complex

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Potassium-transporting ATPase potassium-binding subunit

Escherichia coli

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Potassium-transporting ATPase ATP-binding subunit × 1 （P03960） Potassium-transporting ATPase KdpC subunit × 1 （A0A085P4P2） Potassium-transporting ATPase KdpF subunit × 1 （P36937） POTASSIUM ION × 1 1,2-DIMYRISTOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 octyl beta-D-glucopyranoside × 2 water × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Potassium-transporting ATPase ATP-binding subunit × 1 （P03960） Potassium-transporting ATPase KdpC subunit × 1 （A0A085P4P2） Potassium-transporting ATPase KdpF subunit × 1 （P36937） POTASSIUM ION × 1 1,2-DIMYRISTOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 octyl beta-D-glucopyranoside × 1 water × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 4	Potassium-transporting ATPase ATP-binding subunit × 1 （P03960） Potassium-transporting ATPase KdpC subunit × 1 （A0A085P4P2） Potassium-transporting ATPase KdpF subunit × 1 （P36937） POTASSIUM ION × 1 1,2-DIMYRISTOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 octyl beta-D-glucopyranoside × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	KDPA_ECOLI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–557； UniProt 1–557 Author chain E； PDBConstruct 1–557； UniProt 1–557 Author chain I； PDBConstruct 1–557； UniProt 1–557

Potassium-transporting ATPase ATP-binding subunit

Escherichia coli

UniProt P03960

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Potassium-transporting ATPase potassium-binding subunit × 1 （P03959） Potassium-transporting ATPase KdpC subunit × 1 （A0A085P4P2） Potassium-transporting ATPase KdpF subunit × 1 （P36937） POTASSIUM ION × 1 1,2-DIMYRISTOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 octyl beta-D-glucopyranoside × 2 water × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Potassium-transporting ATPase potassium-binding subunit × 1 （P03959） Potassium-transporting ATPase KdpC subunit × 1 （A0A085P4P2） Potassium-transporting ATPase KdpF subunit × 1 （P36937） POTASSIUM ION × 1 1,2-DIMYRISTOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 octyl beta-D-glucopyranoside × 1 water × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 4	Potassium-transporting ATPase potassium-binding subunit × 1 （P03959） Potassium-transporting ATPase KdpC subunit × 1 （A0A085P4P2） Potassium-transporting ATPase KdpF subunit × 1 （P36937） POTASSIUM ION × 1 1,2-DIMYRISTOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 octyl beta-D-glucopyranoside × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	KDPB_ECOLI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–674； UniProt 9–682 Author chain F； PDBConstruct 1–674； UniProt 9–682 Author chain J； PDBConstruct 1–674； UniProt 9–682

Potassium-transporting ATPase KdpC subunit

Escherichia coli

UniProt A0A085P4P2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Potassium-transporting ATPase potassium-binding subunit × 1 （P03959） Potassium-transporting ATPase ATP-binding subunit × 1 （P03960） Potassium-transporting ATPase KdpF subunit × 1 （P36937） POTASSIUM ION × 1 1,2-DIMYRISTOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 octyl beta-D-glucopyranoside × 2 water × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Potassium-transporting ATPase potassium-binding subunit × 1 （P03959） Potassium-transporting ATPase ATP-binding subunit × 1 （P03960） Potassium-transporting ATPase KdpF subunit × 1 （P36937） POTASSIUM ION × 1 1,2-DIMYRISTOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 octyl beta-D-glucopyranoside × 1 water × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 4	Potassium-transporting ATPase potassium-binding subunit × 1 （P03959） Potassium-transporting ATPase ATP-binding subunit × 1 （P03960） Potassium-transporting ATPase KdpF subunit × 1 （P36937） POTASSIUM ION × 1 1,2-DIMYRISTOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 octyl beta-D-glucopyranoside × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A085P4P2_ECOLX
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–187； UniProt 4–190 Author chain G； PDBConstruct 1–187； UniProt 4–190 Author chain K； PDBConstruct 1–187； UniProt 4–190

Potassium-transporting ATPase KdpF subunit

Escherichia coli

UniProt P36937

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Potassium-transporting ATPase potassium-binding subunit × 1 （P03959） Potassium-transporting ATPase ATP-binding subunit × 1 （P03960） Potassium-transporting ATPase KdpC subunit × 1 （A0A085P4P2） POTASSIUM ION × 1 1,2-DIMYRISTOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 octyl beta-D-glucopyranoside × 2 water × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Potassium-transporting ATPase potassium-binding subunit × 1 （P03959） Potassium-transporting ATPase ATP-binding subunit × 1 （P03960） Potassium-transporting ATPase KdpC subunit × 1 （A0A085P4P2） POTASSIUM ION × 1 1,2-DIMYRISTOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 octyl beta-D-glucopyranoside × 1 water × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 4	Potassium-transporting ATPase potassium-binding subunit × 1 （P03959） Potassium-transporting ATPase ATP-binding subunit × 1 （P03960） Potassium-transporting ATPase KdpC subunit × 1 （A0A085P4P2） POTASSIUM ION × 1 1,2-DIMYRISTOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 octyl beta-D-glucopyranoside × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	KDPF_ECOLI
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–27； UniProt 1–27 Author chain H； PDBConstruct 1–27； UniProt 1–27 Author chain L； PDBConstruct 1–27； UniProt 1–27

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5mrw
Deposition date deposition_date	2016-12-27
Structure title title	Structure of the KdpFABC complex
Keywords keywords	membrane protein complex potassium transport P-type ATPase SKT channel, Hydrolase; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5mrw__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5mrw__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5mrw__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	41.49 Å
Rg (electron density)	40.82 Å
Total Rg	40.76 Å
Atom count	10901
Residues	1444
Excluded volume	198090 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5mrw__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`5mrw__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`5mrw__assembly_3__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Potassium-transporting ATPase potassium-binding subunit
Molecular weight formula_weight	59247.7 kDa
Mutation mutation	Q116R
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,E,I
Atom count atom_count	32666

MAAQGFLLIATFLLVLMVLARPLGSGLARLINDIPLPGTTGVERVLFRALGVSDREMNWKQYLCAILGLNMLGLAVLFFMLLGQHYLPLNPQQLPGLSWDLALNTAVSFVTNTNWRSYSGETTLSYFSQMAGLTVQNFLSAASGIAVIFALIRAFTRQSMSTLGNAWVDLLRITLWVLVPVALLIALFFIQQGALQNFLPYQAVNTVEGAQQLLPMGPVASQEAIKMLGTNGGGFFNANSSHPFENPTALTNFVQMLAIFLIPTALCFAFGEVMGDRRQGRMLLWAMSVIFVICVGVVMWAEVQGNPHLLALGTDSSINMEGKESRFGVLVSSLFAVVTTAASCGAVIAMHDSFTALGGMVPMWLMQIGEVVFGGVGSGLYGMMLFVLLAVFIAGLMIGRTPEYLGKKIDVREMKLTALAILVTPTLVLMGAALAMMTDAGRSAMLNPGPHGFSEVLYAVSSAANNNGSAFAGLSANSPFWNCLLAFCMFVGRFGVIIPVMAIAGSLVSKKSQAASSGTLPTHGPLFVGLLIGTVLLVGALTFIPALALGPVAEYLS

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Potassium-transporting ATPase ATP-binding subunit
Molecular weight formula_weight	71417.7 kDa
EC 编号 ec_number	3.6.3.12
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,F,J

FEPTLVVQALKEAVKKLNPQAQWRNPVMFIVWIGSLLTTCISIAMASGAMPGNALFSAAISGWLWITVLFANFAEALAEGRSKAQANSLKGVKKTAFARKLREPKYGAAADKVPADQLRKGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGGDFASVTGGTRILSDWLVIECSVNPGETFLDRMIAMVEGAQRRKTPNEIALTILLIALTIVFLLATATLWPFSAWGGNAVSVTVLVALLVCLIPTTIGGLLSAIGVAGMSRMLGANVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVDEKTLADAAQLASLADETPEGRSIVILAKQRFNLRERDVQSLHATFVPFTAQSRMSGINIDNRMIRKGSVDAIRRHVEANGGHFPTDVDQKVDQVARQGATPLVVVEGSRVLGVIALKDIVKGGIKERFAQLRKMGIKTVMITGDNRLTAAAIAAEAGVDDFLAEATPEAKLALIRQYQAEGRLVAMTGDGTNDAPALAQADVAVAMNSGTQAAKEAGNMVDLDSNPTKLIEVVHIGKQMLMTRGSLTTFSIANDVAKYFAIIPAAFAATYPQLNALNIMCLHSPDSAILSAVIFNALIIVFLIPLALKGVSYKPLTASAMLRRNLWIYGLGGLLVPFIGIKVIDLLLTVCGLV

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Potassium-transporting ATPase KdpC subunit
Molecular weight formula_weight	20005.7 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,G,K

LRPALSTFIFLLLITGGVYPLLTTVLGQWWFPWQANGSLIREGDTVRGSALIGQNFTGNGYFHGRPSATAEMPYNPQASGGSNLAVSNPELDKLIAARVAALRAANPDASASVPVELVTASASGLDNNITPQAAAWQIPRVAKARNLSVEQLTQLIAKYSQQPLVKYIGQPVVNIVELNLALDKLDE

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	Potassium-transporting ATPase KdpF subunit
Molecular weight formula_weight	2853.5 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,H,L

MSAGVITGVLLVFLLLGYLVYALINAE

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 non-polymer

Description description	POTASSIUM ION
Molecular weight formula_weight	39.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 6 Entity 6 non-polymer

Description description	1,2-DIMYRISTOYL-SN-GLYCERO-3-PHOSPHOCHOLINE
Molecular weight formula_weight	678.9 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 7 Entity 7 non-polymer

Description description	octyl beta-D-glucopyranoside
Molecular weight formula_weight	292.4 kDa
Source method src_method	man
Copy count entity_count	4

Entity 8 Entity 8 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	3

▼

6. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

Domain ID domain_id	5mrwB01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1110 — Calcium-transporting ATPase, cytoplasmic domain N
Homologous superfamily homologous superfamily	10 — Calcium-transporting ATPase, cytoplasmic domain N

Domain ID domain_id	5mrwF01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1110 — Calcium-transporting ATPase, cytoplasmic domain N
Homologous superfamily homologous superfamily	10 — Calcium-transporting ATPase, cytoplasmic domain N

Domain ID domain_id	5mrwJ01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1110 — Calcium-transporting ATPase, cytoplasmic domain N
Homologous superfamily homologous superfamily	10 — Calcium-transporting ATPase, cytoplasmic domain N

▶

Unit-cell length a length_a	124.720 Å
Unit-cell length b length_b	166.290 Å
Unit-cell length c length_c	196.300 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	107.41 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.900 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.2446
R_work r_work	0.2430
R_free r_free	0.2749

Structure of the KdpFABC complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Potassium-transporting ATPase potassium-binding subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Potassium-transporting ATPase ATP-binding subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Potassium-transporting ATPase KdpC subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Potassium-transporting ATPase KdpF subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5mrw__assembly_1__model_1

5mrw__assembly_1__model_1 | I(q)

5mrw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

6. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

7. Citations (1)