SAXSdb — 8ari

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

C-terminal-binding protein 1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Retinoic acid-induced protein 2 × 10 （Q9Y5P3） NICOTINAMIDE-ADENINE-DINUCLEOTIDE × 24	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CTBP1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 18–457； UniProt 1–440 Author chain B； PDBConstruct 18–457； UniProt 1–440 Author chain C； PDBConstruct 18–457； UniProt 1–440 Author chain D； PDBConstruct 18–457； UniProt 1–440 Author chain E； PDBConstruct 18–457； UniProt 1–440 Author chain F； PDBConstruct 18–457； UniProt 1–440 Author chain G； PDBConstruct 18–457； UniProt 1–440 Author chain H； PDBConstruct 18–457； UniProt 1–440 Author chain I； PDBConstruct 18–457； UniProt 1–440 Author chain J； PDBConstruct 18–457； UniProt 1–440 Author chain K； PDBConstruct 18–457； UniProt 1–440 Author chain L； PDBConstruct 18–457； UniProt 1–440 Author chain M； PDBConstruct 18–457； UniProt 1–440 Author chain N； PDBConstruct 18–457； UniProt 1–440 Author chain O； PDBConstruct 18–457； UniProt 1–440 Author chain P； PDBConstruct 18–457； UniProt 1–440 Author chain Q； PDBConstruct 18–457； UniProt 1–440 Author chain R； PDBConstruct 18–457； UniProt 1–440 Author chain S； PDBConstruct 18–457； UniProt 1–440 Author chain T； PDBConstruct 18–457； UniProt 1–440 Author chain U； PDBConstruct 18–457； UniProt 1–440 Author chain V； PDBConstruct 18–457； UniProt 1–440 Author chain W； PDBConstruct 18–457； UniProt 1–440 Author chain X； PDBConstruct 18–457； UniProt 1–440

Retinoic acid-induced protein 2

Homo sapiens

UniProt Q9Y5P3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	C-terminal-binding protein 1 × 24 （Q13363） NICOTINAMIDE-ADENINE-DINUCLEOTIDE × 24	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RAI2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain a； PDBConstruct 81–129； UniProt 303–362 Author chain b； PDBConstruct 81–129； UniProt 303–362 Author chain c； PDBConstruct 81–129； UniProt 303–362 Author chain d； PDBConstruct 81–129； UniProt 303–362 Author chain e； PDBConstruct 81–129； UniProt 303–362 Author chain f； PDBConstruct 81–129； UniProt 303–362 Author chain g； PDBConstruct 81–129； UniProt 303–362 Author chain h； PDBConstruct 81–129； UniProt 303–362 Author chain i； PDBConstruct 81–129； UniProt 303–362 Author chain j； PDBConstruct 81–129； UniProt 303–362

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8ari
Deposition date deposition_date	2022-08-16
Last revision last_revision	2023-08-23
Structure title title	Cryo-EM structure of human CtBP1/RAI2(303-362) delta(331-341) filament
Keywords keywords	Complex, Tumor suppressor, oncogenic, filament assembly, ANTITUMOR PROTEIN; ANTITUMOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8ari__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8ari__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8ari__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	91.04 Å
Rg (electron density)	93.10 Å
Total Rg	92.89 Å
Atom count	63756
Residues	8160
Excluded volume	1126400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8ari__assembly_1__model_1`	34-meric （34）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	C-terminal-binding protein 1
Molecular weight formula_weight	49525.3 kDa
EC 编号 ec_number	1.1.1.-
Source method src_method	man
Copy count entity_count	24

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X
Atom count atom_count	63756

HHHHHHSAGLEVLFQGPMGSSHLLNKGLPLGVRPPIMNGPLHPRPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLNEAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTLCHILNLYRRATWLHQALREGTRVQSVEQIREVASGAARIRGETLGIIGLGRVGQAVALRAKAFGFNVLFYDPYLSDGVERALGLQRVSTLQDLLFHSDCVTLHCGLNEHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHLTAATHWASMDPAVVHPELNGAAYRYPPGVVGVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHASDQL

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Retinoic acid-induced protein 2
Molecular weight formula_weight	14252.8 kDa
Source method src_method	man
Copy count entity_count	10

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,b,c,d,e,f,g,h,i,j

HHHHHHPMKQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEGSGSGSENLYFQGAMDSRHTVIKMGSENEALDLSMKSVPWLKAGALDLSVAAHRKSEPPPETLYD

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	NICOTINAMIDE-ADENINE-DINUCLEOTIDE
Molecular weight formula_weight	663.4 kDa
Source method src_method	syn
Copy count entity_count	24

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	189823

Cryo-EM structure of human CtBP1/RAI2(303-362) delta(331-341) filament

1. Protein Identity and Related Structures Protein Identity & Related Structures

C-terminal-binding protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Retinoic acid-induced protein 2

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8ari__assembly_1__model_1

8ari__assembly_1__model_1 | I(q)

8ari__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

7. Citations (1)

Cryo-EM structure of human CtBP1/RAI2(303-362) delta(331-341) filament

1. Protein Identity and Related Structures Protein Identity & Related Structures

C-terminal-binding protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Retinoic acid-induced protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8ari__assembly_1__model_1

8ari__assembly_1__model_1 | I(q)

8ari__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

7. Citations (1)