8d4t

Mammalian CIV with GDN bound

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome c oxidase subunit 1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8A, mitochondrial × 1 COPPER (II) ION × 3 MAGNESIUM ION × 1 SODIUM ION × 1 HEME-A × 2 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 2 (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE × 1 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX1_BOVIN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain N； PDBConstruct 1–513； UniProt 1–513

Cytochrome c oxidase subunit 2

OrganismNot specified

UniProt P68530

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8A, mitochondrial × 1 COPPER (II) ION × 3 MAGNESIUM ION × 1 SODIUM ION × 1 HEME-A × 2 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 2 (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE × 1 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX2_BOVIN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain O； PDBConstruct 1–227； UniProt 1–227

Cytochrome c oxidase subunit 3

OrganismNot specified

UniProt P00415

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8A, mitochondrial × 1 COPPER (II) ION × 3 MAGNESIUM ION × 1 SODIUM ION × 1 HEME-A × 2 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 2 (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE × 1 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX3_BOVIN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain P； PDBConstruct 1–258； UniProt 4–261

Cytochrome c oxidase subunit 4 isoform 1, mitochondrial

OrganismNot specified

UniProt P00423

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8A, mitochondrial × 1 COPPER (II) ION × 3 MAGNESIUM ION × 1 SODIUM ION × 1 HEME-A × 2 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 2 (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE × 1 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX41_BOVIN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain Q； PDBConstruct 1–137； UniProt 32–168

Cytochrome c oxidase subunit 5A, mitochondrial

OrganismNot specified

UniProt P00426

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8A, mitochondrial × 1 COPPER (II) ION × 3 MAGNESIUM ION × 1 SODIUM ION × 1 HEME-A × 2 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 2 (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE × 1 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX5A_BOVIN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain R； PDBConstruct 1–102； UniProt 49–150

Cytochrome c oxidase subunit 5B, mitochondrial

OrganismNot specified

UniProt P00428

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8A, mitochondrial × 1 COPPER (II) ION × 3 MAGNESIUM ION × 1 SODIUM ION × 1 HEME-A × 2 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 2 (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE × 1 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX5B_BOVIN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain S； PDBConstruct 1–91； UniProt 35–125

Cytochrome c oxidase subunit 6A2, mitochondrial

OrganismNot specified

UniProt P07471

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8A, mitochondrial × 1 COPPER (II) ION × 3 MAGNESIUM ION × 1 SODIUM ION × 1 HEME-A × 2 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 2 (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE × 1 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CX6A2_BOVIN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain T； PDBConstruct 1–72； UniProt 24–95

Cytochrome c oxidase subunit 6B1

OrganismNot specified

UniProt P00429

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8A, mitochondrial × 1 COPPER (II) ION × 3 MAGNESIUM ION × 1 SODIUM ION × 1 HEME-A × 2 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 2 (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE × 1 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CX6B1_BOVIN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain U； PDBConstruct 1–78； UniProt 9–86

Cytochrome c oxidase subunit 6C

OrganismNot specified

UniProt P04038

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8A, mitochondrial × 1 COPPER (II) ION × 3 MAGNESIUM ION × 1 SODIUM ION × 1 HEME-A × 2 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 2 (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE × 1 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX6C_BOVIN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain V； PDBConstruct 1–70； UniProt 5–74

Cytochrome c oxidase subunit 7A1, mitochondrial

OrganismNot specified

UniProt P07470

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8A, mitochondrial × 1 COPPER (II) ION × 3 MAGNESIUM ION × 1 SODIUM ION × 1 HEME-A × 2 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 2 (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE × 1 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CX7A1_BOVIN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain W； PDBConstruct 1–55； UniProt 22–76

Cytochrome c oxidase subunit 7B, mitochondrial

OrganismNot specified

UniProt P13183

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P00430） Cytochrome c oxidase subunit 8A, mitochondrial × 1 COPPER (II) ION × 3 MAGNESIUM ION × 1 SODIUM ION × 1 HEME-A × 2 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 2 (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE × 1 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX7B_BOVIN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain X； PDBConstruct 1–47； UniProt 32–78

Cytochrome c oxidase subunit 7C, mitochondrial

OrganismNot specified

UniProt P00430

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Cytochrome c oxidase subunit 1 × 1 （P00396） Cytochrome c oxidase subunit 2 × 1 （P68530） Cytochrome c oxidase subunit 3 × 1 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P07471） Cytochrome c oxidase subunit 6B1 × 1 （P00429） Cytochrome c oxidase subunit 6C × 1 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 1 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P13183） Cytochrome c oxidase subunit 8A, mitochondrial × 1 COPPER (II) ION × 3 MAGNESIUM ION × 1 SODIUM ION × 1 HEME-A × 2 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 2 (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE × 1 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX7C_BOVIN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain Y； PDBConstruct 1–46； UniProt 18–63

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8d4t
Deposition date deposition_date	2022-06-02
Structure title title	Mammalian CIV with GDN bound
Keywords keywords	mitochondrial electron transport chain, inhibitor, complex IV, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8d4t__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8d4t__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8d4t__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	38.75 Å
Rg (electron density)	37.55 Å
Total Rg	38.01 Å
Atom count	28177
Residues	1736
Excluded volume	258240 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8d4t__assembly_1__model_1`	tridecameric （13）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (21)

Entity 1 Entity 1 polymer

Description description	Cytochrome c oxidase subunit 1
Molecular weight formula_weight	56964.7 kDa
EC 编号 ec_number	7.1.1.9
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N
Atom count atom_count	28177

MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKREVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNL

Entity 2 Entity 2 polymer

Description description	Cytochrome c oxidase subunit 2
Molecular weight formula_weight	26068.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML

Entity 3 Entity 3 polymer

Description description	Cytochrome c oxidase subunit 3
Molecular weight formula_weight	29587.2 kDa
EC 编号 ec_number	7.1.1.9
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

QTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHMLQALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS

Entity 4 Entity 4 polymer

Description description	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
Molecular weight formula_weight	16153.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

DYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELYRLKFKESFAEMNRSTNEWKTVVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQTKRMLDMKVAPIQGFSAKWDYDKNEWK

Entity 5 Entity 5 polymer

Description description	Cytochrome c oxidase subunit 5A, mitochondrial
Molecular weight formula_weight	11717.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

ETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLD

Entity 6 Entity 6 polymer

Description description	Cytochrome c oxidase subunit 5B, mitochondrial
Molecular weight formula_weight	10018.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

GGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPH

Entity 7 Entity 7 polymer

Description description	Cytochrome c oxidase subunit 6A2, mitochondrial
Molecular weight formula_weight	8368.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

GARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVNPLPTGYE

Entity 8 Entity 8 polymer

Description description	Cytochrome c oxidase subunit 6B1
Molecular weight formula_weight	9282.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

IKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI

Entity 9 Entity 9 polymer

Description description	Cytochrome c oxidase subunit 6C
Molecular weight formula_weight	8235.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

LAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK

Entity 10 Entity 10 polymer

Description description	Cytochrome c oxidase subunit 7A1, mitochondrial
Molecular weight formula_weight	6189.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

FENRVAEKQKLFQEDNGLPVHLKGGATDNILYRVTMTLCLGGTLYSLYCLGWASF

Entity 11 Entity 11 polymer

Description description	Cytochrome c oxidase subunit 7B, mitochondrial
Molecular weight formula_weight	5274.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

DFHDKYGNAVLASGATFCVAVWVYMATQIGIEWNPSPVGRVTPKEWR

Entity 12 Entity 12 polymer

Description description	Cytochrome c oxidase subunit 7C, mitochondrial
Molecular weight formula_weight	5362.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

HYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK

Entity 13 Entity 13 polymer

Description description	Cytochrome c oxidase subunit 8A, mitochondrial
Molecular weight formula_weight	4769.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

IHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRP

Entity 14 Entity 14 non-polymer

Description description	COPPER (II) ION
Molecular weight formula_weight	63.5 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 15 Entity 15 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 16 Entity 16 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 17 Entity 17 non-polymer

Description description	HEME-A
Molecular weight formula_weight	852.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 18 Entity 18 non-polymer

Description description	(1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE
Molecular weight formula_weight	749.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 19 Entity 19 non-polymer

Description description	(1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE
Molecular weight formula_weight	768.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 20 Entity 20 non-polymer

Description description	(3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en
Molecular weight formula_weight	544.8 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 21 Entity 21 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Resolution resolution	3.100 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	3.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	4161

Mammalian CIV with GDN bound

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome c oxidase subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 4 isoform 1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 5A, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 5B, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 6A2, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 6B1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 6C

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 7A1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer