SAXSdb — 8eao

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Peptidoglycan hydrolase gp4

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Portal protein × 12 （P26744）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EXLYS_BPP22
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–149； UniProt 3–151 Author chain C； PDBConstruct 1–149； UniProt 3–151 Author chain E； PDBConstruct 1–149； UniProt 3–151 Author chain G； PDBConstruct 1–149； UniProt 3–151 Author chain I； PDBConstruct 1–149； UniProt 3–151 Author chain K； PDBConstruct 1–149； UniProt 3–151 Author chain M； PDBConstruct 1–149； UniProt 3–151 Author chain O； PDBConstruct 1–149； UniProt 3–151 Author chain Q； PDBConstruct 1–149； UniProt 3–151 Author chain S； PDBConstruct 1–149； UniProt 3–151 Author chain U； PDBConstruct 1–149； UniProt 3–151 Author chain W； PDBConstruct 1–149； UniProt 3–151

Portal protein

OrganismNot specified

UniProt P26744

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Peptidoglycan hydrolase gp4 × 12 （P26746）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PORTL_BPP22
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–621； UniProt 6–626 Author chain D； PDBConstruct 1–621； UniProt 6–626 Author chain F； PDBConstruct 1–621； UniProt 6–626 Author chain H； PDBConstruct 1–621； UniProt 6–626 Author chain J； PDBConstruct 1–621； UniProt 6–626 Author chain L； PDBConstruct 1–621； UniProt 6–626 Author chain N； PDBConstruct 1–621； UniProt 6–626 Author chain P； PDBConstruct 1–621； UniProt 6–626 Author chain R； PDBConstruct 1–621； UniProt 6–626 Author chain T； PDBConstruct 1–621； UniProt 6–626 Author chain V； PDBConstruct 1–621； UniProt 6–626 Author chain X； PDBConstruct 1–621； UniProt 6–626

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8eao
Deposition date deposition_date	2022-08-29
Structure title title	Cryo-EM structure of the in-situ gp1-gp4 complex from bacteriophage P22
Keywords keywords	Bacteriophage P22, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8eao__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8eao__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8eao__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	67.06 Å
Rg (electron density)	66.36 Å
Total Rg	66.56 Å
Atom count	71628
Residues	8964
Excluded volume	1265400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8eao__assembly_1__model_1`	24-meric （24）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Peptidoglycan hydrolase gp4
Molecular weight formula_weight	16231.2 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,G,I,K,M,O,Q,S,U,W
Atom count atom_count	71628

IKTKGDLVRAALRKLGVASDATLTDVEPQSMQDAVDDLEAMMAEWYQDGKGIITGYVFSDDENPPAEGDDHGLRSSAVSAVFHNLACRIAPDYALEATAKIIATAKYGKELLYKQTAISRAKRAPYPSRMPTGSGNSFANLNEWHYFPG

Entity 2 Entity 2 polymer

Description description	Portal protein
Molecular weight formula_weight	71116.5 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H,J,L,N,P,R,T,V,X

NRLESILSRFDADWTASDEARREAKNDLFFSRVSQWDDWLSQYTTLQYRGQFDVVRPVVRKLVSEMRQNPIDVLYRPKDGARPDAADVLMGMYRTDMRHNTAKIAVNIAVREQIEAGVGAWRLVTDYEDQSPTSNNQVIRREPIHSACSHVIWDSNSKLMDKSDARHCTVIHSMSQNGWEDFAEKYDLDADDIPSFQNPNDWVFPWLTQDTIQIAEFYEVVEKKETAFIYQDPVTGEPVSYFKRDIKDVIDDLADSGFIKIAERQIKRRRVYKSIITCTAVLKDKQLIAGEHIPIVPVFGEWGFVEDKEVYEGVVRLTKDGQRLRNMIMSFNADIVARTPKKKPFFWPEQIAGFEHMYDGNDDYPYYLLNRTDENSGDLPTQPLAYYENPEVPQANAYMLEAATSAVKEVATLGVDTEAVNGGQVAFDTVNQLNMRADLETYVFQDNLATAMRRDGEIYQSIVNDIYDVPRNVTITLEDGSEKDVQLMAEVVDLATGEKQVLNDIRGRYECYTDVGPSFQSMKQQNRAEILELLGKTPQGTPEYQLLLLQYFTLLDGKGVEMMRDYANKQLIQMGVKKPETPEEQQWLVEAQQAKQGQQDPAMVQAQGVLLQGQAELAKAQ

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.20 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	73420

Cryo-EM structure of the in-situ gp1-gp4 complex from bacteriophage P22

1. Protein Identity and Related Structures Protein Identity & Related Structures

Peptidoglycan hydrolase gp4

State in the Current Structure

Other States of the Same Protein in the Database

Portal protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8eao__assembly_1__model_1

8eao__assembly_1__model_1 | I(q)

8eao__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

7. Citations (1)

Cryo-EM structure of the in-situ gp1-gp4 complex from bacteriophage P22

1. Protein Identity and Related Structures Protein Identity & Related Structures

Peptidoglycan hydrolase gp4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Portal protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8eao__assembly_1__model_1

8eao__assembly_1__model_1 | I(q)

8eao__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

7. Citations (1)