5gai

Probabilistic Structural Models of Mature P22 Bacteriophage Portal, Hub, and Tailspike proteins

Method: ELECTRON MICROSCOPY D_max: 278.3 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Portal protein

Enterobacteria phage P22

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 27 PDB declaration: 27-meric（27） Consistent with protein copy count	Chain A； UniProt 5–725 Chain B； UniProt 5–725 Chain C； UniProt 5–725 Chain D； UniProt 5–725 Chain E； UniProt 5–725 Chain F； UniProt 5–725 Chain G； UniProt 5–725 Chain H； UniProt 5–725 Chain I； UniProt 5–725 Chain J； UniProt 5–725 Chain W； UniProt 5–725 Chain X； UniProt 5–725	Not recorded	Peptidoglycan hydrolase gp4 × 12 （P26746） Tail fiber protein × 3 （P12528）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE；Blot for 2 seconds before plunging.	Resolution 10.50 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 5GAI	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3LJ5 Full Length Bacteriophage P22 Portal Protein Deposited 2010-01-25	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 1–725（725 aa） Fragment：UNP residues 1-725 Chain B 1–725（725 aa） Fragment：UNP residues 1-725 Chain C 1–725（725 aa） Fragment：UNP residues 1-725 Chain D 1–725（725 aa） Fragment：UNP residues 1-725 Chain E 1–725（725 aa） Fragment：UNP residues 1-725 Chain F 1–725（725 aa） Fragment：UNP residues 1-725 Chain G 1–725（725 aa） Fragment：UNP residues 1-725 Chain H 1–725（725 aa） Fragment：UNP residues 1-725 Chain I 1–725（725 aa） Fragment：UNP residues 1-725 Chain J 1–725（725 aa） Fragment：UNP residues 1-725 Chain K 1–725（725 aa） Fragment：UNP residues 1-725 Chain L 1–725（725 aa） Fragment：UNP residues 1-725	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；293 K；30% tert-Butanol, 70mM sodium chloride, 2.5% PEG 400, 0.1M sodium acetate, pH 5.6, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 7.50 Å R-free 0.263
4V4K Bacteriophage P22 Portal Protein bound to middle Tail Factor GP4. This file contain the second biological assembly Deposited 2010-04-19	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain M 1–602（602 aa） Fragment：UNP RESIDUES 1-602 Chain N 1–602（602 aa） Fragment：UNP RESIDUES 1-602 Chain O 1–602（602 aa） Fragment：UNP RESIDUES 1-602 Chain P 1–602（602 aa） Fragment：UNP RESIDUES 1-602 Chain Q 1–602（602 aa） Fragment：UNP RESIDUES 1-602 Chain R 1–602（602 aa） Fragment：UNP RESIDUES 1-602 Chain S 1–602（602 aa） Fragment：UNP RESIDUES 1-602 Chain T 1–602（602 aa） Fragment：UNP RESIDUES 1-602 Chain U 1–602（602 aa） Fragment：UNP RESIDUES 1-602 Chain V 1–602（602 aa） Fragment：UNP RESIDUES 1-602 Chain W 1–602（602 aa） Fragment：UNP RESIDUES 1-602 Chain X 1–602（602 aa） Fragment：UNP RESIDUES 1-602	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 6；20% PEG 8000, 0.1M (NH4)2HPO4, 0.1M MES, PH 6.0, VAPOR DIFFUSION, HANGING DROP, TEMPERATURE 298K	Resolution 3.25 Å R-free 0.236
4V4K Bacteriophage P22 Portal Protein bound to middle Tail Factor GP4. This file contain the second biological assembly Deposited 2010-04-19	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain A 1–602（602 aa） Fragment：UNP RESIDUES 1-602 Chain B 1–602（602 aa） Fragment：UNP RESIDUES 1-602 Chain C 1–602（602 aa） Fragment：UNP RESIDUES 1-602 Chain D 1–602（602 aa） Fragment：UNP RESIDUES 1-602 Chain E 1–602（602 aa） Fragment：UNP RESIDUES 1-602 Chain F 1–602（602 aa） Fragment：UNP RESIDUES 1-602 Chain G 1–602（602 aa） Fragment：UNP RESIDUES 1-602 Chain H 1–602（602 aa） Fragment：UNP RESIDUES 1-602 Chain I 1–602（602 aa） Fragment：UNP RESIDUES 1-602 Chain J 1–602（602 aa） Fragment：UNP RESIDUES 1-602 Chain K 1–602（602 aa） Fragment：UNP RESIDUES 1-602 Chain L 1–602（602 aa） Fragment：UNP RESIDUES 1-602	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 6；20% PEG 8000, 0.1M (NH4)2HPO4, 0.1M MES, PH 6.0, VAPOR DIFFUSION, HANGING DROP, TEMPERATURE 298K	Resolution 3.25 Å R-free 0.236
5JJ1 Structure of the Immature Procapsid Conformation of P22 Portal Protein Deposited 2016-04-22	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 1–602（602 aa） Fragment：UNP residues 1-602 Chain B 1–602（602 aa） Fragment：UNP residues 1-602 Chain C 1–602（602 aa） Fragment：UNP residues 1-602 Chain D 1–602（602 aa） Fragment：UNP residues 1-602 Chain E 1–602（602 aa） Fragment：UNP residues 1-602 Chain F 1–602（602 aa） Fragment：UNP residues 1-602 Chain G 1–602（602 aa） Fragment：UNP residues 1-602 Chain H 1–602（602 aa） Fragment：UNP residues 1-602 Chain I 1–602（602 aa） Fragment：UNP residues 1-602 Chain J 1–602（602 aa） Fragment：UNP residues 1-602 Chain K 1–602（602 aa） Fragment：UNP residues 1-602 Chain L 1–602（602 aa） Fragment：UNP residues 1-602	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.6；293 K；5% PEG 8,000, 10 mM Cesium Chloride	Resolution 3.30 Å R-free 0.315
5JJ3 Refined Structure of the Mature Virion Conformation of P22 Portal Protein Deposited 2016-04-22	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 1–725（725 aa） Chain B 1–725（725 aa） Chain C 1–725（725 aa） Chain D 1–725（725 aa） Chain E 1–725（725 aa） Chain F 1–725（725 aa） Chain G 1–725（725 aa） Chain H 1–725（725 aa） Chain I 1–725（725 aa） Chain J 1–725（725 aa） Chain K 1–725（725 aa） Chain L 1–725（725 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.6；293 K；30% tert-butanol, 70 mM sodium chloride, 2.5% PEG400 in 0.1 M sodium acetate	Resolution 7.00 Å R-free 0.260
8EAO Cryo-EM structure of the in-situ gp1-gp4 complex from bacteriophage P22 Deposited 2022-08-29	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain B 6–626（621 aa） Chain D 6–626（621 aa） Chain F 6–626（621 aa） Chain H 6–626（621 aa） Chain J 6–626（621 aa） Chain L 6–626（621 aa） Chain N 6–626（621 aa） Chain P 6–626（621 aa） Chain R 6–626（621 aa） Chain T 6–626（621 aa） Chain V 6–626（621 aa） Chain X 6–626（621 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8TVU In situ cryo-EM structure of bacteriophage P22 portal protein: head-to-tail protein complex at 3.0A resolution Deposited 2023-08-18	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain A 1–725（725 aa） Chain B 1–725（725 aa） Chain D 1–725（725 aa） Chain F 1–725（725 aa） Chain H 1–725（725 aa） Chain J 1–725（725 aa） Chain L 1–725（725 aa） Chain N 1–725（725 aa） Chain P 1–725（725 aa） Chain R 1–725（725 aa） Chain T 1–725（725 aa） Chain W 1–725（725 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8U10 In situ cryo-EM structure of bacteriophage P22 gp1:gp4:gp5:gp10:gp9 N-term complex in conformation 1 at 3.2A resolution Deposited 2023-08-30	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 58 PDB declaration: 58-meric	Chain a 1–725（725 aa） Chain b 1–725（725 aa） Chain c 1–725（725 aa） Chain d 1–725（725 aa） Chain e 1–725（725 aa） Chain f 1–725（725 aa） Chain g 1–725（725 aa） Chain h 1–725（725 aa） Chain i 1–725（725 aa） Chain j 1–725（725 aa） Chain k 1–725（725 aa） Chain l 1–725（725 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8U11 In situ cryo-EM structure of bacteriophage P22 gp1:gp5:gp4: gp10: gp9 N-term complex in conformation 2 at 3.1A resolution Deposited 2023-08-30	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 58 PDB declaration: 58-meric	Chain a 1–725（725 aa） Chain b 1–725（725 aa） Chain c 1–725（725 aa） Chain d 1–725（725 aa） Chain e 1–725（725 aa） Chain f 1–725（725 aa） Chain g 1–725（725 aa） Chain h 1–725（725 aa） Chain i 1–725（725 aa） Chain j 1–725（725 aa） Chain k 1–725（725 aa） Chain l 1–725（725 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9KYW The scaffold C-loop of phage P22 Deposited 2024-12-09	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–725（725 aa） Chain L 1–725（725 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.70 Å
9PDP In situ cryoEM structure of bacteriophage P22 portal barrel Deposited 2025-06-30	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: 12-meric	Chain A 602–710（109 aa） Chain B 602–710（109 aa） Chain C 602–710（109 aa） Chain D 602–710（109 aa） Chain E 602–710（109 aa） Chain F 602–710（109 aa） Chain G 602–710（109 aa） Chain H 602–710（109 aa） Chain I 602–710（109 aa） Chain J 602–710（109 aa） Chain K 602–710（109 aa） Chain L 602–710（109 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.83 Å
9PGG Cryo-EM structure of bacteriophage P22 gp1-gp5-gp4 complex at 2.76 angstrom Deposited 2025-07-07	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 39 PDB declaration: 39-meric	Chain Bb 1–725（725 aa） Chain Bd 1–725（725 aa） Chain Bf 1–725（725 aa） Chain Bh 1–725（725 aa） Chain Bj 1–725（725 aa） Chain Bl 1–725（725 aa） Chain Bn 1–725（725 aa） Chain Bp 1–725（725 aa） Chain Br 1–725（725 aa） Chain Bt 1–725（725 aa） Chain Bv 1–725（725 aa） Chain Bx 1–725（725 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.76 Å

11 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PORTL_BPP22
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–717； UniProt 5–725 Author chain B； PDBConstruct 1–717； UniProt 5–725 Author chain C； PDBConstruct 1–717； UniProt 5–725 Author chain D； PDBConstruct 1–717； UniProt 5–725 Author chain E； PDBConstruct 1–717； UniProt 5–725 Author chain F； PDBConstruct 1–717； UniProt 5–725 Author chain G； PDBConstruct 1–717； UniProt 5–725 Author chain H； PDBConstruct 1–717； UniProt 5–725 Author chain I； PDBConstruct 1–717； UniProt 5–725 Author chain J； PDBConstruct 1–717； UniProt 5–725 Author chain W； PDBConstruct 1–717； UniProt 5–725 Author chain X； PDBConstruct 1–717； UniProt 5–725

Peptidoglycan hydrolase gp4

Enterobacteria phage P22

UniProt P26746

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 27 PDB declaration: 27-meric（27） Consistent with protein copy count	Chain K； UniProt 5–150 Chain L； UniProt 5–150 Chain M； UniProt 5–150 Chain N； UniProt 5–150 Chain O； UniProt 5–150 Chain P； UniProt 5–150 Chain Q； UniProt 5–150 Chain R； UniProt 5–150 Chain S； UniProt 5–150 Chain T； UniProt 5–150 Chain U； UniProt 5–150 Chain V； UniProt 5–150	Mutation：P150A	Portal protein × 12 （P26744） Tail fiber protein × 3 （P12528）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE；Blot for 2 seconds before plunging.	Resolution 10.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 5GAI	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4V4K Bacteriophage P22 Portal Protein bound to middle Tail Factor GP4. This file contain the second biological assembly Deposited 2010-04-19	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain k 1–166（166 aa） Fragment：UNP RESIDUES 1-166 Chain l 1–166（166 aa） Fragment：UNP RESIDUES 1-166 Chain m 1–166（166 aa） Fragment：UNP RESIDUES 1-166 Chain n 1–166（166 aa） Fragment：UNP RESIDUES 1-166 Chain o 1–166（166 aa） Fragment：UNP RESIDUES 1-166 Chain p 1–166（166 aa） Fragment：UNP RESIDUES 1-166 Chain q 1–166（166 aa） Fragment：UNP RESIDUES 1-166 Chain r 1–166（166 aa） Fragment：UNP RESIDUES 1-166 Chain s 1–166（166 aa） Fragment：UNP RESIDUES 1-166 Chain t 1–166（166 aa） Fragment：UNP RESIDUES 1-166 Chain u 1–166（166 aa） Fragment：UNP RESIDUES 1-166 Chain v 1–166（166 aa） Fragment：UNP RESIDUES 1-166	Mutation：YES Mutation：YES Mutation：YES Mutation：YES Mutation：YES Mutation：YES Mutation：YES Mutation：YES Mutation：YES Mutation：YES Mutation：YES Mutation：YES	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 6；20% PEG 8000, 0.1M (NH4)2HPO4, 0.1M MES, PH 6.0, VAPOR DIFFUSION, HANGING DROP, TEMPERATURE 298K	Resolution 3.25 Å R-free 0.236
4V4K Bacteriophage P22 Portal Protein bound to middle Tail Factor GP4. This file contain the second biological assembly Deposited 2010-04-19	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain Y 1–166（166 aa） Fragment：UNP RESIDUES 1-166 Chain Z 1–166（166 aa） Fragment：UNP RESIDUES 1-166 Chain a 1–166（166 aa） Fragment：UNP RESIDUES 1-166 Chain b 1–166（166 aa） Fragment：UNP RESIDUES 1-166 Chain c 1–166（166 aa） Fragment：UNP RESIDUES 1-166 Chain d 1–166（166 aa） Fragment：UNP RESIDUES 1-166 Chain e 1–166（166 aa） Fragment：UNP RESIDUES 1-166 Chain f 1–166（166 aa） Fragment：UNP RESIDUES 1-166 Chain g 1–166（166 aa） Fragment：UNP RESIDUES 1-166 Chain h 1–166（166 aa） Fragment：UNP RESIDUES 1-166 Chain i 1–166（166 aa） Fragment：UNP RESIDUES 1-166 Chain j 1–166（166 aa） Fragment：UNP RESIDUES 1-166	Mutation：YES Mutation：YES Mutation：YES Mutation：YES Mutation：YES Mutation：YES Mutation：YES Mutation：YES Mutation：YES Mutation：YES Mutation：YES Mutation：YES	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 6；20% PEG 8000, 0.1M (NH4)2HPO4, 0.1M MES, PH 6.0, VAPOR DIFFUSION, HANGING DROP, TEMPERATURE 298K	Resolution 3.25 Å R-free 0.236
8EAO Cryo-EM structure of the in-situ gp1-gp4 complex from bacteriophage P22 Deposited 2022-08-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain A 3–151（149 aa） Chain C 3–151（149 aa） Chain E 3–151（149 aa） Chain G 3–151（149 aa） Chain I 3–151（149 aa） Chain K 3–151（149 aa） Chain M 3–151（149 aa） Chain O 3–151（149 aa） Chain Q 3–151（149 aa） Chain S 3–151（149 aa） Chain U 3–151（149 aa） Chain W 3–151（149 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8EB7 Cryo-EM structure of the in-situ gp4-gp10-gp9N from bacteriophage P22 Deposited 2022-08-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain E 2–151（150 aa） Chain G 2–151（150 aa） Chain H 2–151（150 aa） Chain I 2–151（150 aa） Chain J 2–151（150 aa） Chain K 2–151（150 aa） Chain L 2–151（150 aa） Chain M 2–151（150 aa） Chain N 2–151（150 aa） Chain O 2–151（150 aa） Chain P 2–151（150 aa） Chain Q 2–151（150 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
8TVU In situ cryo-EM structure of bacteriophage P22 portal protein: head-to-tail protein complex at 3.0A resolution Deposited 2023-08-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain C 1–166（166 aa） Chain E 1–166（166 aa） Chain G 1–166（166 aa） Chain I 1–166（166 aa） Chain K 1–166（166 aa） Chain M 1–166（166 aa） Chain O 1–166（166 aa） Chain Q 1–166（166 aa） Chain S 1–166（166 aa） Chain V 1–166（166 aa） Chain X 1–166（166 aa） Chain a 1–166（166 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8U10 In situ cryo-EM structure of bacteriophage P22 gp1:gp4:gp5:gp10:gp9 N-term complex in conformation 1 at 3.2A resolution Deposited 2023-08-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 58 PDB declaration: 58-meric	Chain m 1–166（166 aa） Chain n 1–166（166 aa） Chain o 1–166（166 aa） Chain p 1–166（166 aa） Chain q 1–166（166 aa） Chain r 1–166（166 aa） Chain s 1–166（166 aa） Chain t 1–166（166 aa） Chain u 1–166（166 aa） Chain v 1–166（166 aa） Chain x 1–166（166 aa） Chain y 1–166（166 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8U11 In situ cryo-EM structure of bacteriophage P22 gp1:gp5:gp4: gp10: gp9 N-term complex in conformation 2 at 3.1A resolution Deposited 2023-08-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 58 PDB declaration: 58-meric	Chain m 1–166（166 aa） Chain n 1–166（166 aa） Chain o 1–166（166 aa） Chain p 1–166（166 aa） Chain q 1–166（166 aa） Chain r 1–166（166 aa） Chain s 1–166（166 aa） Chain t 1–166（166 aa） Chain u 1–166（166 aa） Chain v 1–166（166 aa） Chain x 1–166（166 aa） Chain y 1–166（166 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9PGG Cryo-EM structure of bacteriophage P22 gp1-gp5-gp4 complex at 2.76 angstrom Deposited 2025-07-07	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 39 PDB declaration: 39-meric	Chain Ap 1–166（166 aa） Chain Aq 1–166（166 aa） Chain Ar 1–166（166 aa） Chain As 1–166（166 aa） Chain At 1–166（166 aa） Chain Au 1–166（166 aa） Chain Av 1–166（166 aa） Chain Aw 1–166（166 aa） Chain Ax 1–166（166 aa） Chain Ay 1–166（166 aa） Chain Az 1–166（166 aa） Chain Ba 1–166（166 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.76 Å

7 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	EXLYS_BPP22
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain K； PDBConstruct 1–146； UniProt 5–150 Author chain L； PDBConstruct 1–146； UniProt 5–150 Author chain M； PDBConstruct 1–146； UniProt 5–150 Author chain N； PDBConstruct 1–146； UniProt 5–150 Author chain O； PDBConstruct 1–146； UniProt 5–150 Author chain P； PDBConstruct 1–146； UniProt 5–150 Author chain Q； PDBConstruct 1–146； UniProt 5–150 Author chain R； PDBConstruct 1–146； UniProt 5–150 Author chain S； PDBConstruct 1–146； UniProt 5–150 Author chain T； PDBConstruct 1–146； UniProt 5–150 Author chain U； PDBConstruct 1–146； UniProt 5–150 Author chain V； PDBConstruct 1–146； UniProt 5–150

Tail fiber protein

Enterobacteria phage P22

UniProt P12528

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 27 PDB declaration: 27-meric（27） Consistent with protein copy count	Chain 0； UniProt 6–667 Chain Y； UniProt 6–667 Chain Z； UniProt 6–667	Not recorded	Portal protein × 12 （P26744） Peptidoglycan hydrolase gp4 × 12 （P26746）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE；Blot for 2 seconds before plunging.	Resolution 10.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 5GAI	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1CLW TAILSPIKE PROTEIN FROM PHAGE P22, V331A MUTANT Deposited 1999-05-04	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 114–667（554 aa） Fragment：CATALYTIC FRAGMENT	Mutation：V331A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 10；pH 10.00	Resolution 2.00 Å
1CLW TAILSPIKE PROTEIN FROM PHAGE P22, V331A MUTANT Deposited 1999-05-04	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 114–667（554 aa） Fragment：CATALYTIC FRAGMENT	Mutation：V331A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 10；pH 10.00	Resolution 2.00 Å
1LKT CRYSTAL STRUCTURE OF THE HEAD-BINDING DOMAIN OF PHAGE P22 TAILSPIKE PROTEIN Deposited 1997-10-17	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 6–109（104 aa） Fragment：HEAD-BINDING DOMAIN Chain B 6–109（104 aa） Fragment：HEAD-BINDING DOMAIN Chain C 6–109（104 aa） Fragment：HEAD-BINDING DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.6；20% PEG 8K, 0.2 M MGCL2, 0.1 M BIS-TRIS, PH 6.6	Resolution 2.60 Å
1LKT CRYSTAL STRUCTURE OF THE HEAD-BINDING DOMAIN OF PHAGE P22 TAILSPIKE PROTEIN Deposited 1997-10-17	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain D 6–109（104 aa） Fragment：HEAD-BINDING DOMAIN Chain E 6–109（104 aa） Fragment：HEAD-BINDING DOMAIN Chain F 6–109（104 aa） Fragment：HEAD-BINDING DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.6；20% PEG 8K, 0.2 M MGCL2, 0.1 M BIS-TRIS, PH 6.6	Resolution 2.60 Å
1QA1 TAILSPIKE PROTEIN, MUTANT V331G Deposited 1999-04-10	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 114–667（554 aa） Fragment：RECEPTOR BINDING C-TERMINAL DOMAIN	Mutation：V331G	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10；274 K；VAPOR DIFFUSION, HANGING DROP, 274 K, PH 10.0, 1M AMMONIUM SULPHATE 0.1M NA- PHOSPHATE	Resolution 2.00 Å
1QA1 TAILSPIKE PROTEIN, MUTANT V331G Deposited 1999-04-10	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 114–667（554 aa） Fragment：RECEPTOR BINDING C-TERMINAL DOMAIN	Mutation：V331G	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10；274 K；VAPOR DIFFUSION, HANGING DROP, 274 K, PH 10.0, 1M AMMONIUM SULPHATE 0.1M NA- PHOSPHATE	Resolution 2.00 Å
1QA2 TAILSPIKE PROTEIN, MUTANT A334V Deposited 1999-04-10	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 114–667（554 aa） Fragment：RECEPTOR BINDING C-TERMINAL FRAGMENT	Mutation：A334V	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10；277 K；VAPOR DIFFUSION, HANGING DROP, 277K, PH 10.0, 1M AMMONIUM SULPHATE 0.1M NA- PHOSPHATE	Resolution 2.00 Å
1QA2 TAILSPIKE PROTEIN, MUTANT A334V Deposited 1999-04-10	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 114–667（554 aa） Fragment：RECEPTOR BINDING C-TERMINAL FRAGMENT	Mutation：A334V	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10；277 K；VAPOR DIFFUSION, HANGING DROP, 277K, PH 10.0, 1M AMMONIUM SULPHATE 0.1M NA- PHOSPHATE	Resolution 2.00 Å
1QA3 TAILSPIKE PROTEIN, MUTANT A334I Deposited 1999-04-10	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 114–667（554 aa） Fragment：RECEPTOR BINDING C-TERMINAL FRAGMENT	Mutation：A334I	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10；277 K；VAPOR DIFFUSION, HANGING DROP, 277K, PH 10.0, 1M AMMONIUM SULPHATE 0.1M NA- PHOSPHATE	Resolution 2.00 Å
1QA3 TAILSPIKE PROTEIN, MUTANT A334I Deposited 1999-04-10	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 114–667（554 aa） Fragment：RECEPTOR BINDING C-TERMINAL FRAGMENT	Mutation：A334I	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10；277 K；VAPOR DIFFUSION, HANGING DROP, 277K, PH 10.0, 1M AMMONIUM SULPHATE 0.1M NA- PHOSPHATE	Resolution 2.00 Å
1QQ1 TAILSPIKE PROTEIN, MUTANT E359G Deposited 1999-06-10	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 109–667（559 aa） Fragment：C-TERMINAL FRAGMENT	Mutation：E359G	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10；293 K；1M AMMONIUM SULPHATE, 0.1M SODIUM PHOSPHATE, pH 10.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.80 Å
1QRB PLASTICITY AND STERIC STRAIN IN A PARALLEL BETA-HELIX: RATIONAL MUTATIONS IN P22 TAILSPIKE PROTEIN Deposited 1999-06-12	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 109–667（559 aa） Fragment：C-TERMINAL FRAGMENT	Mutation：T326F	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10；293 K；1M AMMONIUM SULPHATE 0.1 M SODIUM PHOSPHATE, pH 10.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.00 Å
1QRC TAILSPIKE PROTEIN, MUTANT W391A Deposited 1999-06-13	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 109–667（559 aa） Fragment：C-TERMINAL FRAGMENT	Mutation：W391A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10；293 K；1M AMMONIUM SULPHATE, 0.1M NA-PHOSPHATE, pH 10.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.50 Å
1TSP CRYSTAL STRUCTURE OF P22 TAILSPIKE PROTEIN: INTERDIGITATED SUBUNITS IN A THERMOSTABLE TRIMER Deposited 1994-06-16	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 109–667（559 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
1TYU STRUCTURE OF TAILSPIKE-PROTEIN Deposited 1996-07-26	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 114–667（554 aa） Fragment：RESIDUES 109-666 LACKING THE N-TERMINAL, HEAD-BINDING DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；COMPLEX FORMED BY SOAKING WITH 2MM OCTASACCHARIDE FROM SALMONELLA ENTERITIDIS AT PH 7.5	Resolution 1.80 Å
1TYV STRUCTURE OF TAILSPIKE-PROTEIN Deposited 1996-07-26	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 114–667（554 aa） Fragment：RESIDUES 109-666 LACKING THE N-TERMINAL, HEAD-BINDING DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.5	Resolution 1.80 Å
1TYW STRUCTURE OF TAILSPIKE-PROTEIN Deposited 1996-07-26	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 114–667（554 aa） Fragment：RESIDUES 109-666 LACKING THE N-TERMINAL, HEAD-BINDING DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；COMPLEX FORMED BY SOAKING WITH DECASACCHARIDE FROM S. TYPHI 253TY O-ANTIGEN AT PH 7.5	Resolution 1.80 Å
1TYX TITLE OF TAILSPIKE-PROTEIN Deposited 1996-07-26	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 114–667（554 aa） Fragment：RESIDUES 109-666 LACKING THE N-TERMINAL, HEAD-BINDING DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；COMPLEX FORMED BY SOAKING WITH 2MM OCTASACCHARIDE FROM SALMONELLA TYPHIMURIUM O-ANTIGEN AT PH 7.5.	Resolution 1.80 Å
2VFM Low Temperature Structure of P22 Tailspike Protein Fragment (109-666) Deposited 2007-11-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 110–667（558 aa） Fragment：RESIDUES 110-667	Not recorded	GOL GLYCEROL × 33 SO4 SULFATE ION × 6 CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions pH 10；DROP: 2 MICROLITER 1.5 M AMMONIUM SULFATE, 0.1 M SODIUM PHOSPHATE, PH 10.0, PLUS 3.3 MICROLITER 10 MG/ML PROTEIN SOLUTION IN 10 MM HEPES, PH 7.0; RESERVOIR: 750 MICOLITER 1.0 M AMMONIUM SULFATE, 0.1 M SODIUM PHOSPHATE, PH 10.0	Resolution 1.50 Å R-free 0.164
2VFN Low Temperature Structure of P22 Tailspike Protein Fragment (109-666), Mutant V125A Deposited 2007-11-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 110–667（558 aa） Fragment：RESIDUES 110-667	Mutation：YES	GOL GLYCEROL × 30 SO4 SULFATE ION × 3 CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions pH 10；DROP: 2 MICROLITER 1.5 M AMMONIUM SULFATE, 0.1 M SODIUM PHOSPHATE, PH 10.0, PLUS 3.3 MICROLITER, 10 MG/ML PROTEIN SOLUTION IN 10 MM HEPES, PH 7.0; RESERVOIR: 750 MICOLITER 1.0 M AMMONIUM SULFATE, 0.1 M SODIUM PHOSPHATE, PH 10.0	Resolution 1.50 Å R-free 0.155
2VFO Low Temperature Structure of P22 Tailspike Protein Fragment (109-666), Mutant V125L Deposited 2007-11-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 110–667（558 aa） Fragment：RESIDUES 110-667	Mutation：YES	GOL GLYCEROL × 21 SO4 SULFATE ION × 3 CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions pH 10；DROP: 2 MICROLITER 1.5 M AMMONIUM SULFATE, 0.1 M SODIUM PHOSPHATE, PH 10.0, PLUS 3.3 MICROLITER 10 MG/ML PROTEIN SOLUTION IN 10 MM HEPES, PH 7.0; RESERVOIR: 750 MICOLITER 1.0 M AMMONIUM SULFATE, 0.1 M SODIUM PHOSPHATE, PH 10.0	Resolution 1.50 Å R-free 0.144
2VFP Low Temperature Structure of P22 Tailspike Protein Fragment (109-666), Mutant V349L Deposited 2007-11-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 110–667（558 aa） Fragment：RESIDUES 110-667	Mutation：YES	GOL GLYCEROL × 18 SO4 SULFATE ION × 3 CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions pH 10；DROP: 2 MICROLITER 1.5 M AMMONIUM SULFATE, 0.1 M SODIUM PHOSPHATE, PH 10.0, PLUS 3.3 MICROLITER 10 MG/ML PROTEIN SOLUTION IN 10 MM HEPES, PH 7.0; RESERVOIR: 750 MICOLITER 1.0 M AMMONIUM SULFATE, 0.1 M SODIUM PHOSPHATE, PH 10.0	Resolution 1.55 Å R-free 0.152
2VFQ Low Temperature Structure of P22 Tailspike Protein Fragment (109-666), Mutant V450A Deposited 2007-11-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 110–667（558 aa） Fragment：RESIDUES 110-667 LACKING THE N-TERMINAL HEAD-BINDING DOMAIN	Mutation：YES	GOL GLYCEROL × 12 SO4 SULFATE ION × 6 CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions pH 10；DROP: 2 MICROLITER 1.5 M AMMONIUM SULFATE, 0.1 M SODIUM PHOSPHATE, PH 10.0, PLUS 3.3 MICROLITER 10 MG/ML PROTEIN SOLUTION IN 10 MM HEPES, PH 7.0; RESERVOIR: 750 MICOLITER 1.0 M AMMONIUM SULFATE, 0.1 M SODIUM PHOSPHATE, PH 10.0	Resolution 1.55 Å R-free 0.145
2VKY Headbinding Domain of Phage P22 Tailspike C-Terminally Fused to Isoleucine Zipper pIIGCN4 (Chimera I) Deposited 2008-01-04	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain B 2–124（123 aa） Fragment：HEAD-BINDING DOMAIN, RESIDUES 2-124	Mutation：YES	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；VAPOR DIFFUSION, HANGING DROP. PROTEIN: CONC. 8.2 MG/ML,BUFFER 50MM HEPES, PH6.5; RESERVOIR: 20% ISOPROPANOL, 0.1M NA-ACETATE, PH4.6, 0.2M CACL2; DROPLET 2 MICROL: 2 MICROL.CRYO:30% GLYCEROL.	Resolution 2.05 Å R-free 0.187
2VNL MUTANT Y108Wdel OF THE HEADBINDING DOMAIN OF PHAGE P22 TAILSPIKE C- TERMINally fused to ISOLEUCINE ZIPPER pIIGCN4 (chimera II) Deposited 2008-02-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 2–122（121 aa） Fragment：HEAD-BINDING DOMAIN, RESIDUES 2-122	Mutation：YES	GOL GLYCEROL × 9	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；VAPOR DIFFUSION, HANGING DROP. PROTEIN: CONC. 9.3 MG/ML,BUFFER 50MM HEPES, PH6.5; RESERVOIR:20% ISOPROPANOL, 0.1M NA-ACETATE, PH4.6, 0.2M CACL2; DROPLET 2 MICROL:2 MICROL.CRYO:30% GLYCEROL.	Resolution 1.80 Å R-free 0.229
2XC1 Full-length Tailspike Protein Mutant Y108W of Bacteriophage P22 Deposited 2010-04-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 2–667（666 aa） Fragment：RESIDUES 2-667 Chain B 2–667（666 aa） Fragment：RESIDUES 2-667 Chain C 2–667（666 aa） Fragment：RESIDUES 2-667	Mutation：YES Mutation：YES Mutation：YES	GOL GLYCEROL × 13 CA CALCIUM ION × 1 PE4 2-{2-[2-(2-{2-[2-(2-ETHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHOXY]-ETHOXY}-ETHANOL × 4 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；292 K；PROTEIN- 15MG/ML IN 10MM HEPES PH7;RESERVOIR:750 ML 0.2M AMMONIUM ACETATE,0.1M TRI-SODIUM CITRATE DIHYDRATE PH 5.6, 30% W/V POLYETHYLENE GLYCOL 4000; HANGING DROPS:1.5MICROL RESERVOIR- 1.5MICROL PROTEIN SOLUTION; TEMPERATURE: 19 DEGR.; CRYO: 3% GLYCEROL	Resolution 1.65 Å R-free 0.210
3TH0 P22 Tailspike complexed with S.Paratyphi O antigen octasaccharide Deposited 2011-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 109–667（559 aa） Fragment：UNP residues 109-657	Not recorded	GOL GLYCEROL × 9	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10；277.15 K；1.5 Ammonium sulfate, 0.1M sodium phosphate over reservoir 1.0 Ammonium sulfate, 0.1M sodium phosphate, pH 10, VAPOR DIFFUSION, HANGING DROP, temperature 277.15K X-ray crystallization conditions MICRODIALYSIS；pH 7.5；293.15 K；addition of 2mM S.Paratyphi o antigen octasaccharide in 0.1M Tris, 1M sodium phosphate, pH 7.5, MICRODIALYSIS, temperature 293.15K	Resolution 1.75 Å R-free 0.156
8EAN Cryo-EM structure of in-situ tailspike in bacteriophage P22 Deposited 2022-08-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain 0 6–667（662 aa） Chain Y 6–667（662 aa） Chain Z 6–667（662 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
8EB7 Cryo-EM structure of the in-situ gp4-gp10-gp9N from bacteriophage P22 Deposited 2022-08-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain 0 6–116（111 aa） Chain A 6–116（111 aa） Chain B 6–116（111 aa） Chain C 6–116（111 aa） Chain D 6–116（111 aa） Chain F 6–116（111 aa） Chain X 6–116（111 aa） Chain Y 6–116（111 aa） Chain Z 6–116（111 aa） Chain a 6–116（111 aa） Chain b 6–116（111 aa） Chain c 6–116（111 aa） Chain d 6–116（111 aa） Chain e 6–116（111 aa） Chain f 6–116（111 aa） Chain g 6–116（111 aa） Chain h 6–116（111 aa） Chain i 6–116（111 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
8TVR In situ cryo-EM structure of bacteriophage P22 tail hub protein: tailspike protein complex at 2.8A resolution Deposited 2023-08-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain A 1–667（667 aa） Chain B 1–667（667 aa） Chain C 1–667（667 aa） Chain D 1–667（667 aa） Chain E 1–667（667 aa） Chain F 1–667（667 aa） Chain H 1–667（667 aa） Chain I 1–667（667 aa） Chain J 1–667（667 aa） Chain L 1–667（667 aa） Chain M 1–667（667 aa） Chain N 1–667（667 aa） Chain P 1–667（667 aa） Chain Q 1–667（667 aa） Chain R 1–667（667 aa） Chain V 1–667（667 aa） Chain W 1–667（667 aa） Chain X 1–667（667 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
8U10 In situ cryo-EM structure of bacteriophage P22 gp1:gp4:gp5:gp10:gp9 N-term complex in conformation 1 at 3.2A resolution Deposited 2023-08-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 58 PDB declaration: 58-meric	Chain 10 1–667（667 aa） Chain 11 1–667（667 aa） Chain 12 1–667（667 aa） Chain 13 1–667（667 aa） Chain 14 1–667（667 aa） Chain 15 1–667（667 aa） Chain 16 1–667（667 aa） Chain 17 1–667（667 aa） Chain 18 1–667（667 aa） Chain 19 1–667（667 aa） Chain 20 1–667（667 aa） Chain 21 1–667（667 aa） Chain 22 1–667（667 aa） Chain 23 1–667（667 aa） Chain 24 1–667（667 aa） Chain 7 1–667（667 aa） Chain 8 1–667（667 aa） Chain 9 1–667（667 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8U11 In situ cryo-EM structure of bacteriophage P22 gp1:gp5:gp4: gp10: gp9 N-term complex in conformation 2 at 3.1A resolution Deposited 2023-08-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 58 PDB declaration: 58-meric	Chain 10 1–667（667 aa） Chain 11 1–667（667 aa） Chain 12 1–667（667 aa） Chain 13 1–667（667 aa） Chain 14 1–667（667 aa） Chain 15 1–667（667 aa） Chain 16 1–667（667 aa） Chain 17 1–667（667 aa） Chain 18 1–667（667 aa） Chain 19 1–667（667 aa） Chain 20 1–667（667 aa） Chain 21 1–667（667 aa） Chain 22 1–667（667 aa） Chain 23 1–667（667 aa） Chain 24 1–667（667 aa） Chain 7 1–667（667 aa） Chain 8 1–667（667 aa） Chain 9 1–667（667 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
8U1O In situ cryo-EM structure of bacteriophage P22 tailspike protein complex at 3.4A resolution Deposited 2023-09-01	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain o 1–667（667 aa） Chain p 1–667（667 aa） Chain q 1–667（667 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å

28 other PDB entries and 33 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FIBER_BPP22
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 0； PDBConstruct 1–662； UniProt 6–667 Author chain Y； PDBConstruct 1–662； UniProt 6–667 Author chain Z； PDBConstruct 1–662； UniProt 6–667

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5gai
Deposition date deposition_date	2015-12-01
Structure title title	Probabilistic Structural Models of Mature P22 Bacteriophage Portal, Hub, and Tailspike proteins
Keywords keywords	virion, portal, tailspike, adhesin, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	— Å
Radius of gyration Rg (electron density) rg_electron	103.20 Å
Forward intensity I(0) i0	27937100000.00
Molecular weight molecular_weight	1392400.0 kDa
Excluded volume excluded_volume	1728200 Å³
Envelope volume envelope_volume	2604400 Å³
Hydration-shell volume shell_volume	245940 Å³
Envelope diameter envelope_diameter	477.2 Å
Shell Rg shell_rg	82.32 Å
Envelope Rg envelope_rg	103.90 Å
Shape Rg shape_rg	103.10 Å
Total Rg total_rg	103.20 Å
Total atoms total_atoms	98043
Residues n_residues	12390
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	278.3 Å
Rg (real space) rg_real	93.01 Å
Rg uncertainty (real space) rg_real_error	1.32 Å
I(0) (real space) i0_real	2.6650e+10
I(0) uncertainty (real space) i0_real_error	5.3560e+08
Rg (reciprocal space) rg_reciprocal	91.04 Å
I(0) (reciprocal space) i0_reciprocal	27120000000.0000
Solution quality estimate total_estimate	0.8848
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	92.8 Å
Skewness Skewness skewness	0.532
Kurtosis Kurtosis kurtosis	-0.395
Angular range angular_range	— – 0.0750 Å⁻¹
Current regularization parameter α current_alpha	0.6142
Highest regularization parameter α highest_alpha	739500000.0000
Real-space data points n_real_points	16
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.018; Oscil: 0.860; Stabil: 0.971; Sysdev: 1.000; Positv: 1.000; Valcen: 0.983; Smooth: 0.042

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Portal protein
Molecular weight formula_weight	82397.9 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,W,X
Atom count atom_count	98043

ENRLESILSRFDADWTASDEARREAKNDLFFSRVSQWDDWLSQYTTLQYRGQFDVVRPVVRKLVSEMRQNPIDVLYRPKDGARPDAADVLMGMYRTDMRHNTAKIAVNIAVREQIEAGVGAWRLVTDYEDQSPTSNNQVIRREPIHSACSHVIWDSNSKLMDKSDARHCTVIHSMSQNGWEDFAEKYDLDADDIPSFQNPNDWVFPWLTQDTIQIAEFYEVVEKKETAFIYQDPVTGEPVSYFKRDIKDVIDDLADSGFIKIAERQIKRRRVYKSIITCTAVLKDKQLIAGEHIPIVPVFGEWGFVEDKEVYEGVVRLTKDGQRLRNMIMSFNADIVARTPKKKPFFWPEQIAGFEHMYDGNDDYPYYLLNRTDENSGDLPTQPLAYYENPEVPQANAYMLEAATSAVKEVATLGVDTEAVNGGQVAFDTVNQLNMRADLETYVFQDNLATAMRRDGEIYQSIVNDIYDVPRNVTITLEDGSEKDVQLMAEVVDLATGEKQVLNDIRGRYECYTDVGPSFQSMKQQNRAEILELLGKTPQGTPEYQLLLLQYFTLLDGKGVEMMRDYANKQLIQMGVKKPETPEEQQWLVEAQQAKQGQQDPAMVQAQGVLLQGQAELAKAQNQTLSLQIDAAKVEAQNQLNAARIAEIFNNMDLSKQSEFREFLKTVASFQQDRSEDARANAELLLKGDEQTHKQRMDIANILQSQRQNQPSGSVAETPQ

来源 Source

来源生物 organism	Enterobacteria phage P22
NCBI Class编号 ncbi_taxonomy_id	10754
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Peptidoglycan hydrolase gp4
Molecular weight formula_weight	15957.8 kDa
Mutation mutation	P150A
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,L,M,N,O,P,Q,R,S,T,U,V

TKGDLVRAALRKLGVASDATLTDVEPQSMQDAVDDLEAMMAEWYQDGKGIITGYVFSDDENPPAEGDDHGLRSSAVSAVFHNLACRIAPDYALEATAKIIATAKYGKELLYKQTAISRAKRAPYPSRMPTGSGNSFPNLNEWHYFP

来源 Source

来源生物 organism	Enterobacteria phage P22
NCBI Class编号 ncbi_taxonomy_id	10754
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Tail fiber protein
Molecular weight formula_weight	71361.9 kDa
EC 编号 ec_number	3.2.1.-
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y,Z,0

ANVVVSNPRPIFTESRSFKAVANGKIYIGQIDTDPVNPANQIPVYIENEDGSHVQITQPLIINAAGKIVYNGQLVKIVTVQGHSMAIYDANGSQVDYIANVLKYDPDQYSIEADKKFKYSVKLSDYPTLQDAASAAVDGLLIDRDYNFYGGETVDFGGKVLTIECKAKFIGDGNLIFTKLGKGSRIAGVFMESTTTPWVIKPWTDDNQWLTDAAAVVATLKQSKTDGYQPTVSDYVKFPGIETLLPPNAKGQNITSTLEIRECIGVEVHRASGLMAGFLFRGCHFCKMVDANNPSGGKDGIITFENLSGDWGKGNYVIGGRTSYGSVSSAQFLRNNGGFERDGGVIGFTSYRAGESGVKTWQGTVGSTTSRNYNLQFRDSVVIYPVWDGFDLGADTDMNPELDRPGDYPITQYPLHQLPLNHLIDNLLVRGALGVGFGMDGKGMYVSNITVEDCAGSGAYLLTHESVFTNIAIIDTNTKDFQANQIYISGACRVNGLRLIGIRSTDGQGLTIDAPNSTVSGITGMVDPSRINVANLAEEGLGNIRANSFGYDSAAIKLRIHKLSKTLDSGALYSHINGGAGSGSAYTQLTAISGSTPDAVSLKVNHKDCRGAEIPFVPDIASDDFIKDSSCFLPYWENNSTSLKALVKKPNGELVRLTLATL

来源 Source

来源生物 organism	Enterobacteria phage P22
NCBI Class编号 ncbi_taxonomy_id	10754
宿主生物 host_organism	Escherichia coli

▶

8. Citations (1)

▶

Resolution resolution	10.50 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	79731

fit	/app/data/saxs_computation/ga/5gai/5gai.fit
pddf	/app/data/pr_computation/ga/5gai/5gai.pr.out
profile	/app/data/saxs_computation/ga/5gai/5gai.dat

Probabilistic Structural Models of Mature P22 Bacteriophage Portal, Hub, and Tailspike proteins

1. Protein Identity and Related Structures Protein Identity & Related Structures

Portal protein

State in the Current Structure

Other States of the Same Protein in the Database

Peptidoglycan hydrolase gp4

State in the Current Structure

Other States of the Same Protein in the Database

Tail fiber protein

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)