8eat

Yeast VO missing subunits a, e, and f in complex with Vma12-22p

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Vacuolar ATPase assembly protein VMA22

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Vacuolar ATPase assembly integral membrane protein VPH2 × 1 （P32341） V-type proton ATPase subunit F × 1 （A0A6A5PYF6） V0 assembly protein 1 × 1 （P53262） ;V-type proton ATPase subunit c'' ; × 1 （P23968） V-type proton ATPase subunit d × 1 （P32366） V-type proton ATPase subunit c × 8 （P25515） ;V-type proton ATPase subunit c' ; × 1 （P32842）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VMA22_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–181； UniProt 1–181

Vacuolar ATPase assembly integral membrane protein VPH2

OrganismNot specified

UniProt P32341

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Vacuolar ATPase assembly protein VMA22 × 1 （P38784） V-type proton ATPase subunit F × 1 （A0A6A5PYF6） V0 assembly protein 1 × 1 （P53262） ;V-type proton ATPase subunit c'' ; × 1 （P23968） V-type proton ATPase subunit d × 1 （P32366） V-type proton ATPase subunit c × 8 （P25515） ;V-type proton ATPase subunit c' ; × 1 （P32842）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VPH2_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–215； UniProt 1–215

V-type proton ATPase subunit F

OrganismNot specified

UniProt A0A6A5PYF6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Vacuolar ATPase assembly protein VMA22 × 1 （P38784） Vacuolar ATPase assembly integral membrane protein VPH2 × 1 （P32341） V0 assembly protein 1 × 1 （P53262） ;V-type proton ATPase subunit c'' ; × 1 （P23968） V-type proton ATPase subunit d × 1 （P32366） V-type proton ATPase subunit c × 8 （P25515） ;V-type proton ATPase subunit c' ; × 1 （P32842）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5PYF6_YEASX
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain F； PDBConstruct 1–118； UniProt 1–118

V0 assembly protein 1

OrganismNot specified

UniProt P53262

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Vacuolar ATPase assembly protein VMA22 × 1 （P38784） Vacuolar ATPase assembly integral membrane protein VPH2 × 1 （P32341） V-type proton ATPase subunit F × 1 （A0A6A5PYF6） ;V-type proton ATPase subunit c'' ; × 1 （P23968） V-type proton ATPase subunit d × 1 （P32366） V-type proton ATPase subunit c × 8 （P25515） ;V-type proton ATPase subunit c' ; × 1 （P32842）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VOA1_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain b； PDBConstruct 1–265； UniProt 1–265

;V-type proton ATPase subunit c'' ;

OrganismNot specified

UniProt P23968

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Vacuolar ATPase assembly protein VMA22 × 1 （P38784） Vacuolar ATPase assembly integral membrane protein VPH2 × 1 （P32341） V-type proton ATPase subunit F × 1 （A0A6A5PYF6） V0 assembly protein 1 × 1 （P53262） V-type proton ATPase subunit d × 1 （P32366） V-type proton ATPase subunit c × 8 （P25515） ;V-type proton ATPase subunit c' ; × 1 （P32842）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VATO_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain c； PDBConstruct 1–213； UniProt 1–213

V-type proton ATPase subunit d

OrganismNot specified

UniProt P32366

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Vacuolar ATPase assembly protein VMA22 × 1 （P38784） Vacuolar ATPase assembly integral membrane protein VPH2 × 1 （P32341） V-type proton ATPase subunit F × 1 （A0A6A5PYF6） V0 assembly protein 1 × 1 （P53262） ;V-type proton ATPase subunit c'' ; × 1 （P23968） V-type proton ATPase subunit c × 8 （P25515） ;V-type proton ATPase subunit c' ; × 1 （P32842）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VA0D_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain d； PDBConstruct 1–345； UniProt 1–345

V-type proton ATPase subunit c

OrganismNot specified

UniProt P25515

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Vacuolar ATPase assembly protein VMA22 × 1 （P38784） Vacuolar ATPase assembly integral membrane protein VPH2 × 1 （P32341） V-type proton ATPase subunit F × 1 （A0A6A5PYF6） V0 assembly protein 1 × 1 （P53262） ;V-type proton ATPase subunit c'' ; × 1 （P23968） V-type proton ATPase subunit d × 1 （P32366） ;V-type proton ATPase subunit c' ; × 1 （P32842）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VATL1_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain g； PDBConstruct 1–160； UniProt 1–160 Author chain h； PDBConstruct 1–160； UniProt 1–160 Author chain i； PDBConstruct 1–160； UniProt 1–160 Author chain j； PDBConstruct 1–160； UniProt 1–160 Author chain k； PDBConstruct 1–160； UniProt 1–160 Author chain l； PDBConstruct 1–160； UniProt 1–160 Author chain m； PDBConstruct 1–160； UniProt 1–160 Author chain n； PDBConstruct 1–160； UniProt 1–160

;V-type proton ATPase subunit c' ;

OrganismNot specified

UniProt P32842

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Vacuolar ATPase assembly protein VMA22 × 1 （P38784） Vacuolar ATPase assembly integral membrane protein VPH2 × 1 （P32341） V-type proton ATPase subunit F × 1 （A0A6A5PYF6） V0 assembly protein 1 × 1 （P53262） ;V-type proton ATPase subunit c'' ; × 1 （P23968） V-type proton ATPase subunit d × 1 （P32366） V-type proton ATPase subunit c × 8 （P25515）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VATL2_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain o； PDBConstruct 1–164； UniProt 1–164

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8eat
Deposition date deposition_date	2022-08-29
Structure title title	Yeast VO missing subunits a, e, and f in complex with Vma12-22p
Keywords keywords	V-type proton ATPase, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8eat__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8eat__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8eat__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	42.83 Å
Rg (electron density)	42.25 Å
Total Rg	42.43 Å
Atom count	34663
Residues	2349
Excluded volume	313430 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8eat__assembly_1__model_1`	pentadecameric （15）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Vacuolar ATPase assembly protein VMA22
Molecular weight formula_weight	21104.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	34663

MSETRMAQNMDTTDEQYLRLIELLSNYDSTLEQLQKGFQDGYIQLSRSNYYNKDSLRGNYGEDYWDETYIGQLMATVEEKNSKVVVEIVKRKAQDKQEKKEEEDNKLTQRKKGTKPEKQKTQSHKLKQDYDPILMFGGVLSVPSSLRQSQTSFKGCIPLIAQLINYKNEILTLVETLSEQE

Entity 2 Entity 2 polymer

Description description	Vacuolar ATPase assembly integral membrane protein VPH2
Molecular weight formula_weight	25325.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MFEIKLNDRITEFLRKFKNSAKSNEGIDEDIDLFLKRHAIPMQSLLFYVKEYRKDSDLQCSIKELLKPLEFEFKPKAVRGLHYSEDFKKKLEFLKYQEQELEYQSMVKRSKSVFSLQEDDELTPSQINKQIKEQVTTVFNVLVSVISVVVAIWYWTGSSTNFPVHVRLLLCLFFGILVLVADVVVYNSYLKKLEEAKVKEKTKVEKKKVLSKITL

Entity 3 Entity 3 polymer

Description description	V-type proton ATPase subunit F
Molecular weight formula_weight	13479.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MAEKRTLIAVIADEDTTTGLLLAGIGQITPETQEKNFFVYQEGKTTKEEITDKFNHFTEERDDIAILLINQHIAENIRARVDSFTNAFPAILEIPSKDHPYDPEKDSVLKRVRKLFGE

Entity 4 Entity 4 polymer

Description description	V0 assembly protein 1
Molecular weight formula_weight	29694.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MVFGQLYALFIFTLSCCISKTVQADSSKESSSFISFDKESNWDTISTISSTADVISSVDSAIAVFEFDNFSLLDNLMIDEEYPFFNRFFANDVSLTVHDDSPLNISQSLSPIMEQFTVDELPESASDLLYEYSLDDKSIVLFKFTSDAYDLKKLDEFIDSCLSFLEDKSGDNLTVVINSLGWAFEDEDGDDEYATEETLSHHDNNKGKEGDDDILSSIWTEGLLMCLIVSALLLFILIVALSWISNLDITYGALEKSTNPIKKNN

Entity 5 Entity 5 polymer

Description description	;V-type proton ATPase subunit c'' ;
Molecular weight formula_weight	22610.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MNKESKDDDMSLGKFSFSHFLYYLVLIVVIVYGLYKLFTGHGSDINFGKFLLRTSPYMWANLGIALCVGLSVVGAAWGIFITGSSMIGAGVRAPRITTKNLISIIFCEVVAIYGLIIAIVFSSKLTVATAENMYSKSNLYTGYSLFWAGITVGASNLICGIAVGITGATAAISDAADSALFVKILVIEIFGSILGLLGLIVGLLMAGKASEFQ

Entity 6 Entity 6 polymer

Description description	V-type proton ATPase subunit d
Molecular weight formula_weight	39822.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MEGVYFNIDNGFIEGVVRGYRNGLLSNNQYINLTQCDTLEDLKLQLSSTDYGNFLSSVSSESLTTSLIQEYASSKLYHEFNYIRDQSSGSTRKFMDYITYGYMIDNVALMITGTIHDRDKGEILQRCHPLGWFDTLPTLSVATDLESLYETVLVDTPLAPYFKNCFDTAEELDDMNIEIIRNKLYKAYLEDFYNFVTEEIPEPAKECMQTLLGFEADRRSINIALNSLQSSDIDPDLKSDLLPNIGKLYPLATFHLAQAQDFEGVRAALANVYEYRGFLETGNLEDHFYQLEMELCRDAFTQQFAISTVWAWMKSKEQEVRNITWIAECIAQNQRERINNYISVY

Entity 7 Entity 7 polymer

Description description	V-type proton ATPase subunit c
Molecular weight formula_weight	16357.5 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g,h,i,j,k,l,m,n

MTELCPVYAPFFGAIGCASAIIFTSLGAAYGTAKSGVGICATCVLRPDLLFKNIVPVIMAGIIAIYGLVVSVLVCYSLGQKQALYTGFIQLGAGLSVGLSGLAAGFAIGIVGDAGVRGSSQQPRLFVGMILILIFAEVLGLYGLIVALLLNSRATQDVVC

Entity 8 Entity 8 polymer

Description description	;V-type proton ATPase subunit c' ;
Molecular weight formula_weight	17046.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o

MSTQLASNIYAPLYAPFFGFAGCAAAMVLSCLGAAIGTAKSGIGIAGIGTFKPELIMKSLIPVVMSGILAIYGLVVAVLIAGNLSPTEDYTLFNGFMHLSCGLCVGFACLSSGYAIGMVGDVGVRKYMHQPRLFVGIVLILIFSEVLGLYGMIVALILNTRGSE

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	114346

Yeast VO missing subunits a, e, and f in complex with Vma12-22p

1. Protein Identity and Related Structures Protein Identity & Related Structures

Vacuolar ATPase assembly protein VMA22

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Vacuolar ATPase assembly integral membrane protein VPH2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit F

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V0 assembly protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

;V-type proton ATPase subunit c'' ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit d

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit c

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

;V-type proton ATPase subunit c' ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8eat__assembly_1__model_1

8eat__assembly_1__model_1 | I(q)

8eat__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer