8emq

Mouse apoferritin heavy chain with zinc determined using single-particle cryo-EM with Apollo camera.

Method: ELECTRON MICROSCOPY D_max: 134.6 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ferritin heavy chain, N-terminally processed

Mus musculus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 24 PDB declaration: 24-meric（24） Consistent with protein copy count	Chain A； UniProt 6–177 Chain B； UniProt 6–177 Chain C； UniProt 6–177 Chain D； UniProt 6–177 Chain E； UniProt 6–177 Chain F； UniProt 6–177 Chain G； UniProt 6–177 Chain H； UniProt 6–177 Chain I； UniProt 6–177 Chain J； UniProt 6–177 Chain K； UniProt 6–177 Chain L； UniProt 6–177 Chain M； UniProt 6–177 Chain N； UniProt 6–177 Chain O； UniProt 6–177 Chain P； UniProt 6–177 Chain Q； UniProt 6–177 Chain R； UniProt 6–177 Chain S； UniProt 6–177 Chain T； UniProt 6–177 Chain U； UniProt 6–177 Chain V； UniProt 6–177 Chain W； UniProt 6–177 Chain X； UniProt 6–177	Not recorded	ZN ZINC ION × 24 FE FE (III) ION × 6	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；DTT are added freshly before use. cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 1.66 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8EMQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
22FX Cryo-EM structure of mouse heavy-chain apoferritin at 1.24 A on CRYO ARM 200 II Deposited 2026-01-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–182（182 aa）	Not recorded	FE FE (III) ION × 24 ZN ZINC ION × 24	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20 mM HEPES-NaOH pH 7.5, 300 mM NaCl, 1 mM dithiothreitol (DTT) cryo-EM vitrification conditions Cryogen ETHANE；3 ul sample, 20 s blot time	Resolution 1.24 Å
22IX cryo-ET subtomogram-averaged structure of mouse heavy-chain apoferritin resolved at 2.71 Angstroms Deposited 2026-01-13	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–182（182 aa） Chain B 1–182（182 aa） Chain C 1–182（182 aa） Chain D 1–182（182 aa） Chain E 1–182（182 aa） Chain F 1–182（182 aa） Chain G 1–182（182 aa） Chain H 1–182（182 aa） Chain I 1–182（182 aa） Chain J 1–182（182 aa） Chain K 1–182（182 aa） Chain L 1–182（182 aa） Chain M 1–182（182 aa） Chain N 1–182（182 aa） Chain O 1–182（182 aa） Chain P 1–182（182 aa） Chain Q 1–182（182 aa） Chain R 1–182（182 aa） Chain S 1–182（182 aa） Chain T 1–182（182 aa） Chain U 1–182（182 aa） Chain V 1–182（182 aa） Chain W 1–182（182 aa） Chain X 1–182（182 aa）	Not recorded	MG MAGNESIUM ION × 38	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；30 mM HEPES 150 mM NaCl 1 mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.71 Å
23WJ Subtomogram average of Apoferrtin (11x11) using CRYO ARM 300II Deposited 2026-02-23	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 6–177（172 aa） Chain B 6–177（172 aa） Chain C 6–177（172 aa） Chain D 6–177（172 aa） Chain E 6–177（172 aa） Chain F 6–177（172 aa） Chain G 6–177（172 aa） Chain H 6–177（172 aa） Chain I 6–177（172 aa） Chain J 6–177（172 aa） Chain K 6–177（172 aa） Chain L 6–177（172 aa） Chain M 6–177（172 aa） Chain N 6–177（172 aa） Chain O 6–177（172 aa） Chain P 6–177（172 aa） Chain Q 6–177（172 aa） Chain R 6–177（172 aa） Chain S 6–177（172 aa） Chain T 6–177（172 aa） Chain U 6–177（172 aa） Chain V 6–177（172 aa） Chain W 6–177（172 aa） Chain X 6–177（172 aa）	Not recorded	FE FE (III) ION × 6 ZN ZINC ION × 24	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.10 Å
3WNW Structure of Mouse H-chain modified ferritin Deposited 2013-12-17	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–182（182 aa） Chain B 1–182（182 aa） Chain C 1–182（182 aa） Chain D 1–182（182 aa） Chain E 1–182（182 aa） Chain F 1–182（182 aa） Chain G 1–182（182 aa） Chain H 1–182（182 aa） Chain I 1–182（182 aa） Chain J 1–182（182 aa） Chain K 1–182（182 aa） Chain L 1–182（182 aa）	Not recorded	MG MAGNESIUM ION × 40 FE FE (III) ION × 8 GOL GLYCEROL × 24 K POTASSIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；286 K；0.1M Na-cacodylate PH 6.5, 0.2 M Mg-Ac, 30% MPD, vapor diffusion, sitting drop, temperature 286K	Resolution 2.24 Å R-free 0.265
5OBA Structure of a modified mouse H-chain ferritin with a lanthanide binding motif Deposited 2017-06-26	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–177（177 aa） Chain B 1–177（177 aa） Chain C 1–177（177 aa） Chain D 1–177（177 aa） Chain E 1–177（177 aa） Chain F 1–177（177 aa） Chain G 1–177（177 aa） Chain H 1–177（177 aa） Chain I 1–177（177 aa） Chain J 1–177（177 aa） Chain K 1–177（177 aa） Chain L 1–177（177 aa） Chain M 1–177（177 aa） Chain N 1–177（177 aa） Chain O 1–177（177 aa） Chain P 1–177（177 aa） Chain Q 1–177（177 aa） Chain R 1–177（177 aa） Chain S 1–177（177 aa） Chain T 1–177（177 aa） Chain U 1–177（177 aa） Chain V 1–177（177 aa） Chain W 1–177（177 aa） Chain X 1–177（177 aa）	Mutation：H177G Mutation：H177G Mutation：H177G Mutation：H177G Mutation：H177G Mutation：H177G Mutation：H177G Mutation：H177G Mutation：H177G Mutation：H177G Mutation：H177G Mutation：H177G Mutation：H177G Mutation：H177G Mutation：H177G Mutation：H177G Mutation：H177G Mutation：H177G Mutation：H177G Mutation：H177G Mutation：H177G Mutation：H177G Mutation：H177G Mutation：H177G	FE FE (III) ION × 32	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；294 K；Ammonium sulphate, Tris-HCl	Resolution 2.85 Å R-free 0.170
5OBB Structure of a modified mouse H chain ferritin with a lanthanide binding motif in complex with Terbium Deposited 2017-06-26	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–177（177 aa） Chain B 1–177（177 aa） Chain C 1–177（177 aa） Chain D 1–177（177 aa） Chain E 1–177（177 aa） Chain F 1–177（177 aa） Chain G 1–177（177 aa） Chain H 1–177（177 aa） Chain I 1–177（177 aa） Chain J 1–177（177 aa） Chain K 1–177（177 aa） Chain L 1–177（177 aa） Chain M 1–177（177 aa） Chain N 1–177（177 aa） Chain O 1–177（177 aa） Chain P 1–177（177 aa） Chain Q 1–177（177 aa） Chain R 1–177（177 aa） Chain S 1–177（177 aa） Chain T 1–177（177 aa） Chain U 1–177（177 aa） Chain V 1–177（177 aa） Chain W 1–177（177 aa） Chain X 1–177（177 aa）	Not recorded	TB TERBIUM(III) ION × 32	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；294 K；ammonium sulphate, TRIS-HCl	Resolution 2.65 Å R-free 0.173
6S61 Apoferritin from mouse at 1.84 angstrom resolution Deposited 2019-07-02	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–182（182 aa） Chain B 1–182（182 aa） Chain C 1–182（182 aa） Chain D 1–182（182 aa） Chain E 1–182（182 aa） Chain F 1–182（182 aa） Chain G 1–182（182 aa） Chain H 1–182（182 aa） Chain I 1–182（182 aa） Chain J 1–182（182 aa） Chain K 1–182（182 aa） Chain L 1–182（182 aa） Chain M 1–182（182 aa） Chain N 1–182（182 aa） Chain O 1–182（182 aa） Chain P 1–182（182 aa） Chain Q 1–182（182 aa） Chain R 1–182（182 aa） Chain S 1–182（182 aa） Chain T 1–182（182 aa） Chain U 1–182（182 aa） Chain V 1–182（182 aa） Chain W 1–182（182 aa） Chain X 1–182（182 aa）	Not recorded	FE FE (III) ION × 6 ZN ZINC ION × 24	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 1.84 Å
6SHT Molecular structure of mouse apoferritin resolved at 2.7 Angstroms with the Glacios cryo-microscope Deposited 2019-08-08	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–182（182 aa）	Not recorded	FE FE (III) ION × 24 MG MAGNESIUM ION × 24	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.73 Å R-free 0.254
6V21 Mouse heavy chain apoferritin determined using single-particle cryo-EM at 200 keV Deposited 2019-11-21	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 5–178（174 aa） Chain B 5–178（174 aa） Chain C 5–178（174 aa） Chain D 5–178（174 aa） Chain E 5–178（174 aa） Chain F 5–178（174 aa） Chain G 5–178（174 aa） Chain H 5–178（174 aa） Chain I 5–178（174 aa） Chain J 5–178（174 aa） Chain K 5–178（174 aa） Chain L 5–178（174 aa） Chain M 5–178（174 aa） Chain N 5–178（174 aa） Chain O 5–178（174 aa） Chain P 5–178（174 aa） Chain Q 5–178（174 aa） Chain R 5–178（174 aa） Chain S 5–178（174 aa） Chain T 5–178（174 aa） Chain U 5–178（174 aa） Chain V 5–178（174 aa） Chain W 5–178（174 aa） Chain X 5–178（174 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3 uL of sample/grid was manually blotted for 4 seconds prior to immediate plunge-freezing in liquid nitrogen-cooled ethane.	Resolution 1.75 Å
7A4M Cryo-EM structure of mouse heavy-chain apoferritin at 1.22 A Deposited 2020-08-20	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 6–177（172 aa）	Not recorded	FE FE (III) ION × 24 ZN ZINC ION × 24	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES pH 7.5 150mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 1.22 Å
7KOD Cryo-EM structure of heavy chain mouse apoferritin Deposited 2020-11-08	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–182（182 aa） Chain B 1–182（182 aa） Chain C 1–182（182 aa） Chain D 1–182（182 aa） Chain E 1–182（182 aa） Chain F 1–182（182 aa） Chain G 1–182（182 aa） Chain H 1–182（182 aa） Chain I 1–182（182 aa） Chain J 1–182（182 aa） Chain K 1–182（182 aa） Chain L 1–182（182 aa） Chain M 1–182（182 aa） Chain N 1–182（182 aa） Chain O 1–182（182 aa） Chain P 1–182（182 aa） Chain Q 1–182（182 aa） Chain R 1–182（182 aa） Chain S 1–182（182 aa） Chain T 1–182（182 aa） Chain U 1–182（182 aa） Chain V 1–182（182 aa） Chain W 1–182（182 aa） Chain X 1–182（182 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 1.66 Å
7TB3 cryo-EM structure of MBP-KIX-apoferritin Deposited 2021-12-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 7–182（176 aa） Chain B 7–182（176 aa） Chain C 7–182（176 aa） Chain D 7–182（176 aa） Chain E 7–182（176 aa） Chain F 7–182（176 aa） Chain G 7–182（176 aa） Chain H 7–182（176 aa） Chain I 7–182（176 aa） Chain J 7–182（176 aa） Chain K 7–182（176 aa） Chain L 7–182（176 aa） Chain M 7–182（176 aa） Chain N 7–182（176 aa） Chain O 7–182（176 aa） Chain P 7–182（176 aa） Chain Q 7–182（176 aa） Chain R 7–182（176 aa） Chain S 7–182（176 aa） Chain T 7–182（176 aa） Chain U 7–182（176 aa） Chain V 7–182（176 aa） Chain W 7–182（176 aa） Chain X 7–182（176 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.57 Å
7TBH cryo-EM structure of MBP-KIX-apoferritin complex with peptide 7 Deposited 2021-12-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 48 PDB declaration: 48-meric	Chain A 7–182（176 aa） Chain B 7–182（176 aa） Chain C 7–182（176 aa） Chain D 7–182（176 aa） Chain E 7–182（176 aa） Chain F 7–182（176 aa） Chain G 7–182（176 aa） Chain H 7–182（176 aa） Chain I 7–182（176 aa） Chain J 7–182（176 aa） Chain K 7–182（176 aa） Chain L 7–182（176 aa） Chain M 7–182（176 aa） Chain N 7–182（176 aa） Chain O 7–182（176 aa） Chain P 7–182（176 aa） Chain Q 7–182（176 aa） Chain R 7–182（176 aa） Chain S 7–182（176 aa） Chain T 7–182（176 aa） Chain U 7–182（176 aa） Chain V 7–182（176 aa） Chain W 7–182（176 aa） Chain X 7–182（176 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.30 Å
8BK9 Cryo-EM structure of mouse heavy-chain apoferritin at 2.1 A plunged 5ms after mixing with b-galactosidase Deposited 2022-11-08	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–182（182 aa） Chain B 1–182（182 aa） Chain C 1–182（182 aa） Chain D 1–182（182 aa） Chain E 1–182（182 aa） Chain F 1–182（182 aa） Chain G 1–182（182 aa） Chain H 1–182（182 aa） Chain I 1–182（182 aa） Chain J 1–182（182 aa） Chain K 1–182（182 aa） Chain L 1–182（182 aa） Chain M 1–182（182 aa） Chain N 1–182（182 aa） Chain O 1–182（182 aa） Chain P 1–182（182 aa） Chain Q 1–182（182 aa） Chain R 1–182（182 aa） Chain S 1–182（182 aa） Chain T 1–182（182 aa） Chain V 1–182（182 aa） Chain W 1–182（182 aa） Chain X 1–182（182 aa） Chain Y 1–182（182 aa）	Not recorded	FE FE (III) ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；contains Amaranth dye (acid red 27) 32 mM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.10 Å
8BKA Cryo-EM structure of mouse heavy-chain apoferritin at 2.7 A plunged 35ms after mixing with b-galactosidase Deposited 2022-11-08	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–182（182 aa） Chain B 1–182（182 aa） Chain C 1–182（182 aa） Chain D 1–182（182 aa） Chain E 1–182（182 aa） Chain F 1–182（182 aa） Chain G 1–182（182 aa） Chain H 1–182（182 aa） Chain I 1–182（182 aa） Chain J 1–182（182 aa） Chain K 1–182（182 aa） Chain L 1–182（182 aa） Chain M 1–182（182 aa） Chain N 1–182（182 aa） Chain O 1–182（182 aa） Chain P 1–182（182 aa） Chain Q 1–182（182 aa） Chain R 1–182（182 aa） Chain S 1–182（182 aa） Chain T 1–182（182 aa） Chain V 1–182（182 aa） Chain W 1–182（182 aa） Chain X 1–182（182 aa） Chain Y 1–182（182 aa）	Not recorded	FE FE (III) ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；contains Amaranth dye (acid red 27) 32 mM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
8BKB Cryo-EM structure of mouse heavy-chain apoferritin at 2.2 A plunged 205ms after mixing with b-galactosidase Deposited 2022-11-08	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–182（182 aa） Chain B 1–182（182 aa） Chain C 1–182（182 aa） Chain D 1–182（182 aa） Chain E 1–182（182 aa） Chain F 1–182（182 aa） Chain G 1–182（182 aa） Chain H 1–182（182 aa） Chain I 1–182（182 aa） Chain J 1–182（182 aa） Chain K 1–182（182 aa） Chain L 1–182（182 aa） Chain M 1–182（182 aa） Chain N 1–182（182 aa） Chain O 1–182（182 aa） Chain P 1–182（182 aa） Chain Q 1–182（182 aa） Chain R 1–182（182 aa） Chain S 1–182（182 aa） Chain T 1–182（182 aa） Chain V 1–182（182 aa） Chain W 1–182（182 aa） Chain X 1–182（182 aa） Chain Y 1–182（182 aa）	Not recorded	FE FE (III) ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；contains Amaranth dye (acid red 27) 32 mM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.20 Å
8EN7 Mouse apoferritin heavy chain without zinc determined using single-particle cryo-EM with Apollo camera. Deposited 2022-09-28	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 6–177（172 aa） Chain B 6–177（172 aa） Chain C 6–177（172 aa） Chain D 6–177（172 aa） Chain E 6–177（172 aa） Chain F 6–177（172 aa） Chain G 6–177（172 aa） Chain H 6–177（172 aa） Chain I 6–177（172 aa） Chain J 6–177（172 aa） Chain K 6–177（172 aa） Chain L 6–177（172 aa） Chain M 6–177（172 aa） Chain N 6–177（172 aa） Chain O 6–177（172 aa） Chain P 6–177（172 aa） Chain Q 6–177（172 aa） Chain R 6–177（172 aa） Chain S 6–177（172 aa） Chain T 6–177（172 aa） Chain U 6–177（172 aa） Chain V 6–177（172 aa） Chain W 6–177（172 aa） Chain X 6–177（172 aa）	Not recorded	FE FE (III) ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；DTT are added freshly before use. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 1.68 Å
8J5A Single-particle cryo-EM structure of mouse apoferritin at 1.19 Angstrom resolution (Dataset A) Deposited 2023-04-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 6–177（172 aa）	Not recorded	NA SODIUM ION × 24	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 1.19 Å
8J5A Single-particle cryo-EM structure of mouse apoferritin at 1.19 Angstrom resolution (Dataset A) Deposited 2023-04-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 6–177（172 aa）	Not recorded	NA SODIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 1.19 Å
8J5A Single-particle cryo-EM structure of mouse apoferritin at 1.19 Angstrom resolution (Dataset A) Deposited 2023-04-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 6–177（172 aa）	Not recorded	NA SODIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 1.19 Å
8PVC Structure of mouse heavy-chain apoferritin determined by cryoEM at 100 keV Deposited 2023-07-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–182（182 aa）	Not recorded	FE FE (III) ION × 24 ZN ZINC ION × 24	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
8RQB Cryo-EM structure of mouse heavy-chain apoferritin Deposited 2024-01-17	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 6–177（172 aa） Chain B 6–177（172 aa） Chain C 6–177（172 aa） Chain D 6–177（172 aa） Chain E 6–177（172 aa） Chain F 6–177（172 aa） Chain G 6–177（172 aa） Chain H 6–177（172 aa） Chain I 6–177（172 aa） Chain J 6–177（172 aa） Chain K 6–177（172 aa） Chain L 6–177（172 aa） Chain M 6–177（172 aa） Chain N 6–177（172 aa） Chain O 6–177（172 aa） Chain P 6–177（172 aa） Chain Q 6–177（172 aa） Chain R 6–177（172 aa） Chain S 6–177（172 aa） Chain T 6–177（172 aa） Chain U 6–177（172 aa） Chain V 6–177（172 aa） Chain W 6–177（172 aa） Chain X 6–177（172 aa）	Not recorded	FE FE (III) ION × 6 ZN ZINC ION × 24	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 1.09 Å
8T4Q 2.07 Angstrom CryoEM Structure of Heavy Chain Apoferritin from Mus Musculus From 200kV Microscope Deposited 2023-06-09	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 6–177（172 aa） Chain B 6–177（172 aa） Chain C 6–177（172 aa） Chain D 6–177（172 aa） Chain E 6–177（172 aa） Chain F 6–177（172 aa） Chain G 6–177（172 aa） Chain H 6–177（172 aa） Chain I 6–177（172 aa） Chain J 6–177（172 aa） Chain K 6–177（172 aa） Chain L 6–177（172 aa） Chain M 6–177（172 aa） Chain N 6–177（172 aa） Chain O 6–177（172 aa） Chain P 6–177（172 aa） Chain Q 6–177（172 aa） Chain R 6–177（172 aa） Chain S 6–177（172 aa） Chain T 6–177（172 aa） Chain U 6–177（172 aa） Chain V 6–177（172 aa） Chain W 6–177（172 aa） Chain X 6–177（172 aa）	Not recorded	FE FE (III) ION × 24	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.07 Å
8TU7 Cryo-EM structure of Apoferritin collected by EPU on Glacios at 2.5 Angstrom resolution Deposited 2023-08-15	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–182（182 aa） Chain B 1–182（182 aa） Chain C 1–182（182 aa） Chain D 1–182（182 aa） Chain E 1–182（182 aa） Chain F 1–182（182 aa） Chain G 1–182（182 aa） Chain H 1–182（182 aa） Chain I 1–182（182 aa） Chain J 1–182（182 aa） Chain K 1–182（182 aa） Chain L 1–182（182 aa） Chain M 1–182（182 aa） Chain N 1–182（182 aa） Chain O 1–182（182 aa） Chain P 1–182（182 aa） Chain Q 1–182（182 aa） Chain R 1–182（182 aa） Chain S 1–182（182 aa） Chain T 1–182（182 aa） Chain U 1–182（182 aa） Chain V 1–182（182 aa） Chain W 1–182（182 aa） Chain X 1–182（182 aa）	Not recorded	FE FE (III) ION × 6 ZN ZINC ION × 24	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
8TU8 Cryo-EM structure of Apoferritin collected by SerialEM on Glacios at 2.1 Angstrom resolution Deposited 2023-08-15	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–182（182 aa） Chain B 1–182（182 aa） Chain C 1–182（182 aa） Chain D 1–182（182 aa） Chain E 1–182（182 aa） Chain F 1–182（182 aa） Chain G 1–182（182 aa） Chain H 1–182（182 aa） Chain I 1–182（182 aa） Chain J 1–182（182 aa） Chain K 1–182（182 aa） Chain L 1–182（182 aa） Chain M 1–182（182 aa） Chain N 1–182（182 aa） Chain O 1–182（182 aa） Chain P 1–182（182 aa） Chain Q 1–182（182 aa） Chain R 1–182（182 aa） Chain S 1–182（182 aa） Chain T 1–182（182 aa） Chain U 1–182（182 aa） Chain V 1–182（182 aa） Chain W 1–182（182 aa） Chain X 1–182（182 aa）	Not recorded	FE FE (III) ION × 6 ZN ZINC ION × 24	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.10 Å
8TUE Cryo-EM structure of Apoferritin collected by Leginon on Glacios at 2.1 Angstrom resolution Deposited 2023-08-16	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–182（182 aa） Chain B 1–182（182 aa） Chain C 1–182（182 aa） Chain D 1–182（182 aa） Chain E 1–182（182 aa） Chain F 1–182（182 aa） Chain G 1–182（182 aa） Chain H 1–182（182 aa） Chain I 1–182（182 aa） Chain J 1–182（182 aa） Chain K 1–182（182 aa） Chain L 1–182（182 aa） Chain M 1–182（182 aa） Chain N 1–182（182 aa） Chain O 1–182（182 aa） Chain P 1–182（182 aa） Chain Q 1–182（182 aa） Chain R 1–182（182 aa） Chain S 1–182（182 aa） Chain T 1–182（182 aa） Chain U 1–182（182 aa） Chain V 1–182（182 aa） Chain W 1–182（182 aa） Chain X 1–182（182 aa）	Not recorded	ZN ZINC ION × 24 FE FE (III) ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.10 Å
9IUY Cryo-EM structure of mouse heavy-chain apoferritin resolved at 1.51 Angstroms Deposited 2024-07-22	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 1–182（182 aa） Chain B 1–182（182 aa） Chain C 1–182（182 aa） Chain D 1–182（182 aa） Chain E 1–182（182 aa） Chain F 1–182（182 aa） Chain G 1–182（182 aa） Chain H 1–182（182 aa） Chain I 1–182（182 aa） Chain J 1–182（182 aa） Chain K 1–182（182 aa） Chain L 1–182（182 aa） Chain M 1–182（182 aa） Chain N 1–182（182 aa） Chain O 1–182（182 aa） Chain P 1–182（182 aa） Chain Q 1–182（182 aa） Chain R 1–182（182 aa） Chain S 1–182（182 aa） Chain T 1–182（182 aa） Chain U 1–182（182 aa） Chain V 1–182（182 aa） Chain W 1–182（182 aa） Chain X 1–182（182 aa）	Not recorded	MG MAGNESIUM ION × 32 K POTASSIUM ION × 24 FE FE (III) ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；30 mM HEPES, 150 mM NaCl, 1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 1.51 Å
9WAL Apoferritin (118% Super resolution Nyquist, 236% physical Nyquist) by PASR on Acquisition-time Super Resolution K3 data Deposited 2025-08-12	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain A 5–178（174 aa） Chain B 5–178（174 aa） Chain C 5–178（174 aa） Chain D 5–178（174 aa） Chain E 5–178（174 aa） Chain F 5–178（174 aa） Chain G 5–178（174 aa） Chain H 5–178（174 aa） Chain I 5–178（174 aa） Chain J 5–178（174 aa） Chain K 5–178（174 aa） Chain L 5–178（174 aa） Chain M 5–178（174 aa） Chain N 5–178（174 aa） Chain O 5–178（174 aa） Chain P 5–178（174 aa） Chain Q 5–178（174 aa） Chain R 5–178（174 aa） Chain S 5–178（174 aa） Chain T 5–178（174 aa） Chain U 5–178（174 aa） Chain V 5–178（174 aa） Chain W 5–178（174 aa） Chain X 5–178（174 aa）	Not recorded	FE FE (III) ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 1.67 Å

26 other PDB entries and 28 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FRIH_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–172； UniProt 6–177 Author chain B； PDBConstruct 1–172； UniProt 6–177 Author chain C； PDBConstruct 1–172； UniProt 6–177 Author chain D； PDBConstruct 1–172； UniProt 6–177 Author chain E； PDBConstruct 1–172； UniProt 6–177 Author chain F； PDBConstruct 1–172； UniProt 6–177 Author chain G； PDBConstruct 1–172； UniProt 6–177 Author chain H； PDBConstruct 1–172； UniProt 6–177 Author chain I； PDBConstruct 1–172； UniProt 6–177 Author chain J； PDBConstruct 1–172； UniProt 6–177 Author chain K； PDBConstruct 1–172； UniProt 6–177 Author chain L； PDBConstruct 1–172； UniProt 6–177 Author chain M； PDBConstruct 1–172； UniProt 6–177 Author chain N； PDBConstruct 1–172； UniProt 6–177 Author chain O； PDBConstruct 1–172； UniProt 6–177 Author chain P； PDBConstruct 1–172； UniProt 6–177 Author chain Q； PDBConstruct 1–172； UniProt 6–177 Author chain R； PDBConstruct 1–172； UniProt 6–177 Author chain S； PDBConstruct 1–172； UniProt 6–177 Author chain T； PDBConstruct 1–172； UniProt 6–177 Author chain U； PDBConstruct 1–172； UniProt 6–177 Author chain V； PDBConstruct 1–172； UniProt 6–177 Author chain W； PDBConstruct 1–172； UniProt 6–177 Author chain X； PDBConstruct 1–172； UniProt 6–177

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8emq
Deposition date deposition_date	2022-09-28
Structure title title	Mouse apoferritin heavy chain with zinc determined using single-particle cryo-EM with Apollo camera.
Keywords keywords	bind with iron, METAL BINDING PROTEIN; METAL BINDING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	53.82 Å
Radius of gyration Rg (electron density) rg_electron	52.87 Å
Forward intensity I(0) i0	3547750000.00
Molecular weight molecular_weight	482520.0 kDa
Excluded volume excluded_volume	596130 Å³
Envelope volume envelope_volume	955000 Å³
Hydration-shell volume shell_volume	147320 Å³
Envelope diameter envelope_diameter	134.6 Å
Shell Rg shell_rg	63.51 Å
Envelope Rg envelope_rg	47.63 Å
Shape Rg shape_rg	52.87 Å
Total Rg total_rg	53.17 Å
Total atoms total_atoms	33846
Residues n_residues	4128
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	134.6 Å
Rg (real space) rg_real	53.28 Å
Rg uncertainty (real space) rg_real_error	0.37 Å
I(0) (real space) i0_real	3.5480e+09
I(0) uncertainty (real space) i0_real_error	5.1520e+07
Rg (reciprocal space) rg_reciprocal	54.26 Å
I(0) (reciprocal space) i0_reciprocal	3553000000.0000
Solution quality estimate total_estimate	0.7970
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	88.2 Å
Skewness Skewness skewness	-0.392
Kurtosis Kurtosis kurtosis	-0.640
Angular range angular_range	— – 0.1450 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	212600000000.0000
Real-space data points n_real_points	30
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.828; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.871; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Ferritin heavy chain, N-terminally processed
Molecular weight formula_weight	20079.6 kDa
Source method src_method	man
Copy count entity_count	24

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X
Atom count atom_count	37805

PSQVRQNYHQDAEAAINRQINLELYASYVYLSMSCYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDRDDWESGLNAMECALHLEKSVNQSLLELHKLATDKNDPHLCDFIETYYLSEQVKSIKELGDHVTNLRKMGAPEAGMAEYLFDKHTLG

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	house mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	24

Entity 3 Entity 3 non-polymer

Description description	FE (III) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	2975

▼

7. Fold Classification (SCOP + CATH) 24 domains

CATH v4.4 (24 domains)

Domain ID domain_id	8emqA01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	10 — Ferritin, core subunit, four-helix bundle

Domain ID domain_id	8emqB01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	10 — Ferritin, core subunit, four-helix bundle

Domain ID domain_id	8emqC01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	10 — Ferritin, core subunit, four-helix bundle

Domain ID domain_id	8emqD01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	10 — Ferritin, core subunit, four-helix bundle

Domain ID domain_id	8emqE01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	10 — Ferritin, core subunit, four-helix bundle

Domain ID domain_id	8emqF01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	10 — Ferritin, core subunit, four-helix bundle

Domain ID domain_id	8emqG01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	10 — Ferritin, core subunit, four-helix bundle

Domain ID domain_id	8emqH01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	10 — Ferritin, core subunit, four-helix bundle

Domain ID domain_id	8emqI01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	10 — Ferritin, core subunit, four-helix bundle

Domain ID domain_id	8emqJ01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	10 — Ferritin, core subunit, four-helix bundle

Domain ID domain_id	8emqK01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	10 — Ferritin, core subunit, four-helix bundle

Domain ID domain_id	8emqL01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	10 — Ferritin, core subunit, four-helix bundle

Domain ID domain_id	8emqM01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	10 — Ferritin, core subunit, four-helix bundle

Domain ID domain_id	8emqN01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	10 — Ferritin, core subunit, four-helix bundle

Domain ID domain_id	8emqO01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	10 — Ferritin, core subunit, four-helix bundle

Domain ID domain_id	8emqP01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	10 — Ferritin, core subunit, four-helix bundle

Domain ID domain_id	8emqQ01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	10 — Ferritin, core subunit, four-helix bundle

Domain ID domain_id	8emqR01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	10 — Ferritin, core subunit, four-helix bundle

Domain ID domain_id	8emqS01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	10 — Ferritin, core subunit, four-helix bundle

Domain ID domain_id	8emqT01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	10 — Ferritin, core subunit, four-helix bundle

Domain ID domain_id	8emqU01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	10 — Ferritin, core subunit, four-helix bundle

Domain ID domain_id	8emqV01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	10 — Ferritin, core subunit, four-helix bundle

Domain ID domain_id	8emqW01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	10 — Ferritin, core subunit, four-helix bundle

Domain ID domain_id	8emqX01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	10 — Ferritin, core subunit, four-helix bundle

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	1.66 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	286970

fit	/app/data/saxs_computation/em/8emq/8emq.fit
pddf	/app/data/pr_computation/em/8emq/8emq.pr.out
profile	/app/data/saxs_computation/em/8emq/8emq.dat