SAXSdb — 8eqb

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Terminal nucleotidyltransferase 5C

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Synthetic nanobody 1 × 4 Isoform 2 of BRCA2 and CDKN1A-interacting protein × 4 （Q9P287-2）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TET5C_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 6–205； UniProt 15–214 Author chain E； PDBConstruct 6–205； UniProt 15–214 Author chain H； PDBConstruct 6–205； UniProt 15–214 Author chain K； PDBConstruct 6–205； UniProt 15–214

Isoform 2 of BRCA2 and CDKN1A-interacting protein

Homo sapiens

UniProt Q9P287-2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Synthetic nanobody 1 × 4 Terminal nucleotidyltransferase 5C × 4 （Q5VWP2）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BCCIP_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 6–254； UniProt 50–322 Author chain F； PDBConstruct 6–254； UniProt 50–322 Author chain I； PDBConstruct 6–254； UniProt 50–322 Author chain L； PDBConstruct 6–254； UniProt 50–322

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8eqb
Deposition date deposition_date	2022-10-07
Structure title title	FAM46C/BCCIPalpha/Nanobody complex
Keywords keywords	FAM46, BCCIP, poly-A polymerase, alternative splicing, NUCLEAR PROTEIN; NUCLEAR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8eqb__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8eqb__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8eqb__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	47.45 Å
Rg (electron density)	46.43 Å
Total Rg	46.79 Å
Atom count	14740
Residues	1916
Excluded volume	263940 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8eqb__assembly_1__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Synthetic nanobody 1
Molecular weight formula_weight	13719.4 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D,G,J
Atom count atom_count	14740

GPHMQVQLQESGGGLVQAGGSLRLSCAASGTISPRGVMGWYRQAPGKEREFVAAINYGGTTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAVYYYINSQRKVLLYWGQGTQVTVSS

Source Source

Source organism organism	Lama glama
Common name common_name	llama
NCBI taxonomy ID ncbi_taxonomy_id	9844
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Terminal nucleotidyltransferase 5C
Molecular weight formula_weight	24533.3 kDa
EC 编号 ec_number	2.7.7.19,2.7.7.19
Mutation mutation	E166Q
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,E,H,K

GPGAPSVLNWDQVSRLHEVLTEVVPIHGRGNFPTLEITLKDIVQTVRSRLEEAGIKVHDVRLNGSAAGHVLVKDNGLGCKDLDLIFHVALPTEAEFQLVRDVVLCSLLNFLPEGVNKLKISPVTLKEAYVQKLVKVCTDTDRWSLISLSNKNGKNVQLKFVDSIRRQFEFSVDSFQIILDSLLFFYDCSNNPISEHFHPTVIGESXXXXXXXXXXXXXXXXXXX

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Isoform 2 of BRCA2 and CDKN1A-interacting protein
Molecular weight formula_weight	28190.1 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,F,I,L

GPGAPDEVIDEEVNIEFEAYSLSDNDYDGIKKLLQQLFLKAPVNTAELTDLLIQQNHIGSVIKQTDVEVFGFISLLNLTERKGTQCVEQIQELVLRFCEKNCEKSMVEQLDKFLNDTTKPVGLLLSERFINVPPQIALPMYQQLQKELAGAHRTNKPCGKCYFYLLISKTFVEAGKNNSAALMFANAEEEFFYEEQGKPEVLGGPDTRPVPIQHNGGSRGQVTALVSLKAGLIQSRSTLSDFQGTFMTVGIALS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	6.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	7376

FAM46C/BCCIPalpha/Nanobody complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Terminal nucleotidyltransferase 5C

State in the Current Structure

Other States of the Same Protein in the Database

Isoform 2 of BRCA2 and CDKN1A-interacting protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8eqb__assembly_1__model_1

8eqb__assembly_1__model_1 | I(q)

8eqb__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (1)

FAM46C/BCCIPalpha/Nanobody complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Terminal nucleotidyltransferase 5C

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Isoform 2 of BRCA2 and CDKN1A-interacting protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8eqb__assembly_1__model_1

8eqb__assembly_1__model_1 | I(q)

8eqb__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (1)