SAXSdb — 8ezj

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ARF guanine-nucleotide exchange factor 2

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	ADP-ribosylation factor-like protein 1 × 2 （P38116） GUANOSINE-5'-TRIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GEA2_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 25–1483； UniProt 1–1459 Author chain B； PDBConstruct 25–1483； UniProt 1–1459

ADP-ribosylation factor-like protein 1

Saccharomyces cerevisiae

UniProt P38116

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	ARF guanine-nucleotide exchange factor 2 × 2 （P39993） GUANOSINE-5'-TRIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ARL1_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–166； UniProt 18–183 Author chain D； PDBConstruct 1–166； UniProt 18–183

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8ezj
Deposition date deposition_date	2022-11-01
Structure title title	Cryo-EM structure of the S. cerevisiae Arf-like protein Arl1 bound to the Arf guanine nucleotide exchange factor Gea2
Keywords keywords	;small GTPase, guanine nucleotide exchange factor, membrane trafficking, lipid flippase, trans-Golgi network, protein transport, LIPID TRANSPORT ;; LIPID TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8ezj__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8ezj__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8ezj__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	73.10 Å
Rg (electron density)	74.65 Å
Total Rg	74.33 Å
Atom count	23215
Residues	2891
Excluded volume	418380 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8ezj__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	ARF guanine-nucleotide exchange factor 2
Molecular weight formula_weight	168590.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	23215

MHHHHHHSSGVDLGTENLYFQSNAMSDREFVTVDPVTIIIKECINLSTAMRKYSKFTSQSGVAALLGGGSEIFSNQDDYLAHTFNNLNTNKHNDPFLSGFIQLRLMLNKLKNLDNIDSLTILQPFLLIVSTSSISGYITSLALDSLQKFFTLNIINESSQNYIGAHRATVNALTHCRFEGSQQLSDDSVLLKVVFLLRSIVDSPYGDLLSNSIIYDVLQTILSLACNNRRSEVLRNAAQSTMIAVTVKIFSKLKTIEPVNVNQIYINDESYTNDVLKADTIGTNVESKEEGSQEDPIGMKVNNEEAISEDDGIEEEHIHSEKSTNGAEQLDIVQKTTRSNSRIQAYADDNYGLPVVRQYLNLLLSLIAPENELKHSYSTRIFGLELIQTALEISGDRLQLYPRLFTLISDPIFKSILFIIQNTTKLSLLQATLQLFTTLVVILGNNLQLQIELTLTRIFSILLDDGTANNSSSENKNKPSIIKELLIEQISILWTRSPSFFTSTFINFDCNLDRADVSINFLKALTKLALPESALTTTESVPPICLEGLVSLVDDMFDHMKDIDREEFGRQKNEMEILKKRDRKTEFIECTNAFNEKPKKGIPMLIEKGFIASDSDKDIAEFLFNNNNRMNKKTIGLLLCHPDKVSLLNEYIRLFDFSGLRVDEAIRILLTKFRLPGESQQIERIIEAFSSAYCENQDYDPSKISDNAEDDISTVQPDADSVFILSYSIIMLNTDLHNPQVKEHMSFEDYSGNLKGCCNHKDFPFWYLDRIYCSIRDKEIVMPEEHHGNEKWFEDAWNNLISSTTVITEIKKDTQSVMDKLTPLELLNFDRAIFKQVGPSIVSTLFNIYVVASDDHISTRMITSLDKCSYISAFFDFKDLFNDILNSIAKGTTLINSSHDDELSTLAFEYGPMPLVQIKFEDTNTEIPVSTDAVRFGRSFKGQLNTVVFFRIIRRNKDPKIFSKELWLNIVNIILTLYEDLILSPDIFPDLQKRLKLSNLPKPSPEISINKSKESKGLLSTFASYLKGDEEPTEEEIKSSKKAMECIKSSNIAASVFGNESNITADLIKTLLDSAKTEKNADNSRYFEAELLFIIELTIALFLFCKEEKELGKFILQKVFQLSHTKGLTKRTVRRMLTYKILLISLCADQTEYLSKLINDELLKKGDIFTQKFFATNQGKEFLKRLFSLTESEFYRGFLLGNENFWKFLRKVTAMKEQSESIFEYLNESIKTDSNILTNENFMWVLGLLDEISSMGAVGNHWEIEYKKLTESGHKIDKENPYKKSIELSLKSIQLTSHLLEDNNDLRKNEIFAIIQALAHQCINPCKQISEFAVVTLEQTLINKIEIPTNEMESVEELIEGGLLPLLNSSETQEDQKILISSILTIISNVYLHYLKLGKTSNETFLKILSIFNKFVEDSDIEKKLQQLILDKKSIEKGNGSSSHGSAHEQTPESNDVEIEATAPIDDNTDDDNKPKLSDVEKD

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	ADP-ribosylation factor-like protein 1
Molecular weight formula_weight	20460.2 kDa
Mutation mutation	Q72L
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

ELRILILGLDGAGKTTILYRLQIGEVVTTKPTIGFNVETLSYKNLKLNVWDLGGLTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQDAALLVFANKQDQPGALSASEVSKELNLVELKDRSWSIVASSAIKGEGITEGLDWLIDVIKEEQLAGENLYFQSAGHHHHHH

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.30 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	712548

Cryo-EM structure of the S. cerevisiae Arf-like protein Arl1 bound to the Arf guanine nucleotide exchange factor Gea2

1. Protein Identity and Related Structures Protein Identity & Related Structures

ARF guanine-nucleotide exchange factor 2

State in the Current Structure

Other States of the Same Protein in the Database

ADP-ribosylation factor-like protein 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8ezj__assembly_1__model_1

8ezj__assembly_1__model_1 | I(q)

8ezj__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

7. Citations (1)

Cryo-EM structure of the S. cerevisiae Arf-like protein Arl1 bound to the Arf guanine nucleotide exchange factor Gea2

1. Protein Identity and Related Structures Protein Identity & Related Structures

ARF guanine-nucleotide exchange factor 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ADP-ribosylation factor-like protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8ezj__assembly_1__model_1

8ezj__assembly_1__model_1 | I(q)

8ezj__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

7. Citations (1)