SAXSdb — 8f6x

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Structurally designed HMPV F protein HMPV_v3B_D12_DS454,Fibritin

Escherichia phage T2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 6	MPE8 Single chain variable fragment × 3 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2Z5WL46_BPT2
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 472–498； UniProt 458–484 Author chain B； PDBConstruct 472–498； UniProt 458–484 Author chain C； PDBConstruct 472–498； UniProt 458–484

Structurally designed HMPV F protein HMPV_v3B_D12_DS454,Fibritin

Escherichia phage T2

UniProt G3KCK8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 6	MPE8 Single chain variable fragment × 3 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G3KCK8_9MONO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–88； UniProt 1–88 Author chain A； PDBConstruct 95–467； UniProt 113–485 Author chain B； PDBConstruct 1–88； UniProt 1–88 Author chain B； PDBConstruct 95–467； UniProt 113–485 Author chain C； PDBConstruct 1–88； UniProt 1–88 Author chain C； PDBConstruct 95–467； UniProt 113–485

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8f6x
Deposition date deposition_date	2022-11-17
Structure title title	cryo-EM structure of a structurally designed Human metapneumovirus F protein in complex with antibody MPE8
Keywords keywords	metapneumovirus, HMPV, F protein, antibody, MPE8, VIRAL PROTEIN, VIRAL PROTEIN-IMMUNE SYSTEM complex; VIRAL PROTEIN/IMMUNE SYSTEM
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8f6x__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8f6x__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8f6x__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	39.45 Å
Rg (electron density)	38.98 Å
Total Rg	39.31 Å
Atom count	14952
Residues	1980
Excluded volume	265310 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8f6x__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Structurally designed HMPV F protein HMPV_v3B_D12_DS454,Fibritin
Molecular weight formula_weight	56891.6 kDa
Mutation mutation	several mutations introduced to structurally redesign the F protein
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	14952

MSWKVMIIISLLITPQHGLKESYLEESCSTITEGYLSVLRTGWYTNVFTLEVGDVENLTCTDGPSLIKTELDLTKSALRELKTCSADQGSGGSGATAAAVTAGIAIAKTIRLESEVNAIKGCLKTTNECVSTLGNGVRVLATAVRELKEFVSKNLTSAINKNKCDIPDLKMAVSFSQFNRRFLNVVRQFSDNAGITPAISLDLMTDAELARAVSYMPTSAGQIKLMLENRCMVRRKGFGILIGVYGSSVIYMVQLPIFGVIDTPCWIIKAAPSCSEKDGNYACLLREDQGWYCKNAGSTVYYPNDKDCETRGDHVFCDTAAGINVAEQSRECNINISTTNYPCKVSTGRHPISMVALSPLGALVACYKGVSCSIGSNRVGIIKQLPKGCSYITNQDADTVTIDNTVYQLSKVEGEQHVIKGRPVSSSFDPIKFPECQFNCALDQVFESIENSQALVDQSNKILNSAESAIGGYIPEAPRDGQAYVRKDGEWVLLSTFLGGLVPRGSHHHHHHSAWSHPQFEK

Source Source

Source organism organism	Escherichia phage T2
NCBI taxonomy ID ncbi_taxonomy_id	2060721
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	MPE8 Single chain variable fragment
Molecular weight formula_weight	32012.1 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F

MELGLRWVFLVAILEGVQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISASSSYSDYADSAKGRFTISRDNAKTSLFLQMNSLRAEDTAIYFCARARATGYSSITPYFDIWGQGTLVTVSSGTGGSGGGGSGGGGSGGGASQSVVTQTPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYDNNNRPSGVPDRFSASKSGTSASLAITGLQAEDEADYYCQSYDRNLSGVFGTGTKVTVLGSGENLYFQSGGSGGHHHHHHHHSAWSHPQFEK

Source Source

Source organism organism	Homo sapiens
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	man
Copy count entity_count	3

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.25 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	192259

cryo-EM structure of a structurally designed Human metapneumovirus F protein in complex with antibody MPE8

1. Protein Identity and Related Structures Protein Identity & Related Structures

Structurally designed HMPV F protein HMPV_v3B_D12_DS454,Fibritin

State in the Current Structure

Other States of the Same Protein in the Database

Structurally designed HMPV F protein HMPV_v3B_D12_DS454,Fibritin

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8f6x__assembly_1__model_1

8f6x__assembly_1__model_1 | I(q)

8f6x__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

7. Citations (1)

cryo-EM structure of a structurally designed Human metapneumovirus F protein in complex with antibody MPE8

1. Protein Identity and Related Structures Protein Identity & Related Structures

Structurally designed HMPV F protein HMPV_v3B_D12_DS454,Fibritin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Structurally designed HMPV F protein HMPV_v3B_D12_DS454,Fibritin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8f6x__assembly_1__model_1

8f6x__assembly_1__model_1 | I(q)

8f6x__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

7. Citations (1)