SAXSdb — 6w52

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion glycoprotein F0

Human respiratory syncytial virus A (strain A2)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 4	Fusion glycoprotein F1 fused with Fibritin trimerization domain × 1 （A0A2H4WLA4,A0A2Z5WL46） RSB1 Fab Heavy Chain × 1 RSB1 Fab Light Chain × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FUS_HRSVA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–82； UniProt 26–107

Fusion glycoprotein F1 fused with Fibritin trimerization domain

Escherichia phage T2

UniProt A0A2H4WLA4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 4	Fusion glycoprotein F0 × 1 （P03420） RSB1 Fab Heavy Chain × 1 RSB1 Fab Light Chain × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2H4WLA4_HRSV
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–377； UniProt 137–513

Fusion glycoprotein F1 fused with Fibritin trimerization domain

Escherichia phage T2

UniProt A0A2Z5WL46

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 4	Fusion glycoprotein F0 × 1 （P03420） RSB1 Fab Heavy Chain × 1 RSB1 Fab Light Chain × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2Z5WL46_9CAUD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 382–408； UniProt 458–484

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6w52
Deposition date deposition_date	2020-03-12
Structure title title	Prefusion RSV F bound by neutralizing antibody RSB1
Keywords keywords	RSV, antibody, neutralization, prefusion, vaccine, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6w52__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6w52__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6w52__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	42.90 Å
Rg (electron density)	43.60 Å
Total Rg	43.45 Å
Atom count	6632
Residues	872
Excluded volume	118450 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6w52__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Fusion glycoprotein F0
Molecular weight formula_weight	9215.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	6632

QNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRA

Source Source

Source organism organism	Human respiratory syncytial virus A (strain A2)
NCBI taxonomy ID ncbi_taxonomy_id	11259
Host organism host_organism	Cricetulus griseus

Entity 2 Entity 2 polymer

Description description	Fusion glycoprotein F1 fused with Fibritin trimerization domain
Molecular weight formula_weight	45609.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

FLGFLLGVGSAIASGVAVCKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTFKVLDLKNYIDKQLLPILNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMCIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLSAIGGYIPEAPRDGQAYVRKDGEWVLLSTFLGGLVPR

Source Source

Source organism organism	Escherichia phage T2
NCBI taxonomy ID ncbi_taxonomy_id	2060721
Host organism host_organism	Cricetulus griseus

Entity 3 Entity 3 polymer

Description description	RSB1 Fab Heavy Chain
Molecular weight formula_weight	29977.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MEFGLSWVFLVAILEGVHCQVQLVQSGAEVKKPGSSVKVSCKTSGGTYGTYSINWVRQAPGQGLEWMGAIIPIFGKTNYAQKFQGRVTITADASTSTAYMELGSLTSEDTAMYYCARVEDTALDHYFDYWGQGALVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKGSENLYFQGGWSHPQFEKGGGSGGGSGGGSWSHPQFEK

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	RSB1 Fab Light Chain
Molecular weight formula_weight	25137.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

METPAELLFLLLLWLPDTTGQSALTQPRSVSGSPGQSVTISCTGTSGDVGTYNYVSWYQQLPGKAPKLMIYDVTRRPSGVPDRFSGSKSGNTASLTISGLQADDEADYYCCSYAGTLTWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

▶

Unit-cell length a length_a	190.298 Å
Unit-cell length b length_b	190.298 Å
Unit-cell length c length_c	190.298 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	I 21 3
Space-group number int_tables_number	199
Crystal system crystal_system	cubic

Resolution resolution	3.740 Å
Low-resolution limit resolution_low	40.570 Å
R factor r_factor	0.2251
R_work r_work	0.2180
R_free r_free	0.2863

Prefusion RSV F bound by neutralizing antibody RSB1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion glycoprotein F0

State in the Current Structure

Other States of the Same Protein in the Database

Fusion glycoprotein F1 fused with Fibritin trimerization domain

State in the Current Structure

Other States of the Same Protein in the Database

Fusion glycoprotein F1 fused with Fibritin trimerization domain

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6w52__assembly_1__model_1

6w52__assembly_1__model_1 | I(q)

6w52__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

7. Citations (1)

Prefusion RSV F bound by neutralizing antibody RSB1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion glycoprotein F0

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Fusion glycoprotein F1 fused with Fibritin trimerization domain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Fusion glycoprotein F1 fused with Fibritin trimerization domain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6w52__assembly_1__model_1

6w52__assembly_1__model_1 | I(q)

6w52__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

7. Citations (1)