SAXSdb — 8fj2

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Evasin P1243

Amblyomma americanum

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 21–123	Not recorded	C-C motif chemokine 17 × 1 （Q92583）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；298 K；4.3 M NaCl, 0.1 M HEPES pH 7.4	Resolution 2.07 Å R-free 0.231
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 21–123	Not recorded	C-C motif chemokine 17 × 1 （Q92583）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；298 K；4.3 M NaCl, 0.1 M HEPES pH 7.4	Resolution 2.07 Å R-free 0.231

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8FJ2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7SCS Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL11 Deposited 2021-09-29	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 24–123（100 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M BIS-TRIS 6.5 pH (Buffer) , 2 M (NH4)2SO4 (Precipitant)	Resolution 1.51 Å R-free 0.206
7SCT Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL16 Deposited 2021-09-29	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 24–123（100 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.26 M (NH4)2SO4 (Precipitant),0.1 M HEPES 7.5 pH (Buffer)	Resolution 1.84 Å R-free 0.210
7SCU Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL7 Deposited 2021-09-29	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 24–123（100 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M Na Acet 4.6 pH (Buffer),2 M NaCl (Precipitant)	Resolution 1.86 Å R-free 0.210
7SCV Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL17 Deposited 2021-09-29	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 24–123（100 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M Na Acet 4.6 pH (Buffer),2 M NaCl (Precipitant)	Resolution 2.01 Å R-free 0.251
8FJ0 Crystal Structure of the Tick Evasin EVA-AAM1001(Y44A) Complexed to Human Chemokine CCL2 Deposited 2022-12-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 21–123（103 aa） Chain B 21–123（103 aa） Chain C 21–123（103 aa）	Mutation：Y44A Mutation：Y44A Mutation：Y44A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；2 M NH4SO4, 0.1 M bis-tris, Ph 5.6	Resolution 2.91 Å R-free 0.284
8FJ3 Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL7(Y13A) Deposited 2022-12-19	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 24–123（100 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；2 M NH2SO4, 0.1 Na acetate, pH 4.8	Resolution 2.07 Å R-free 0.229
8FK6 Crystal Structure of the Tick Evasin EVA-AAM1001(Y44A) Complexed to Human Chemokine CCL7 Deposited 2022-12-20	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 21–123（103 aa）	Mutation：Y44A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；2 M Ammonium sulfate	Resolution 1.74 Å R-free 0.223
8FK8 Crystal Structure of the Tick Evasin EVA-AAM1001(L39P) Complexed to Human Chemokine CCL7 Deposited 2022-12-20	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 21–123（103 aa）	Mutation：L39P	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；2 M Ammonium sulfate	Resolution 1.96 Å R-free 0.263
8SKK Crystal Structure of the Tick Evasin EVA-AAM1001(L39P) Complexed to Human Chemokine CCL17 Deposited 2023-04-19	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 21–123（103 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；291 K；2M Ammonium sulfate, 0.1 M HEPES pH 7.0	Resolution 2.10 Å R-free 0.211

9 other PDB entries and 9 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	E1243_AMBAM
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–103； UniProt 21–123

C-C motif chemokine 17

Homo sapiens

UniProt Q92583

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 24–94	Not recorded	Evasin P1243 × 1 （A0A0C9S461）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；298 K；4.3 M NaCl, 0.1 M HEPES pH 7.4	Resolution 2.07 Å R-free 0.231
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 24–94	Not recorded	Evasin P1243 × 1 （A0A0C9S461）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；298 K；4.3 M NaCl, 0.1 M HEPES pH 7.4	Resolution 2.07 Å R-free 0.231

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8FJ2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1NR2 High resolution crystal structures of thymus and activation-regulated chemokine Deposited 2003-01-23	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 24–94（71 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.6；288 K；0.17M ammonium acetate, 0.085M trisodium citrate, 25.5% PEG 4000, 15% w/v glycerol, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 288K	Resolution 2.18 Å R-free 0.299
1NR2 High resolution crystal structures of thymus and activation-regulated chemokine Deposited 2003-01-23	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 24–94（71 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.6；288 K；0.17M ammonium acetate, 0.085M trisodium citrate, 25.5% PEG 4000, 15% w/v glycerol, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 288K	Resolution 2.18 Å R-free 0.299
1NR4 High resolution crystal structures of thymus and activation-regulated chemokine Deposited 2003-01-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 24–94（71 aa） Chain B 24–94（71 aa）	Not recorded	SO4 SULFATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；285 K；0.16M ammonium sulfate, 0.08M Sodium acetate, 20% PEG 4000, 15% glycerol, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 285K	Resolution 1.72 Å R-free 0.239
1NR4 High resolution crystal structures of thymus and activation-regulated chemokine Deposited 2003-01-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 24–94（71 aa） Chain D 24–94（71 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；285 K；0.16M ammonium sulfate, 0.08M Sodium acetate, 20% PEG 4000, 15% glycerol, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 285K	Resolution 1.72 Å R-free 0.239
1NR4 High resolution crystal structures of thymus and activation-regulated chemokine Deposited 2003-01-23	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 24–94（71 aa） Chain F 24–94（71 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；285 K；0.16M ammonium sulfate, 0.08M Sodium acetate, 20% PEG 4000, 15% glycerol, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 285K	Resolution 1.72 Å R-free 0.239
1NR4 High resolution crystal structures of thymus and activation-regulated chemokine Deposited 2003-01-23	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain G 24–94（71 aa） Chain H 24–94（71 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；285 K；0.16M ammonium sulfate, 0.08M Sodium acetate, 20% PEG 4000, 15% glycerol, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 285K	Resolution 1.72 Å R-free 0.239
1NR4 High resolution crystal structures of thymus and activation-regulated chemokine Deposited 2003-01-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 24–94（71 aa） Chain B 24–94（71 aa） Chain C 24–94（71 aa） Chain D 24–94（71 aa） Chain E 24–94（71 aa） Chain F 24–94（71 aa） Chain G 24–94（71 aa） Chain H 24–94（71 aa）	Not recorded	SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；285 K；0.16M ammonium sulfate, 0.08M Sodium acetate, 20% PEG 4000, 15% glycerol, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 285K	Resolution 1.72 Å R-free 0.239
5WK3 CRYSTAL STRUCTURE OF THE COMPLEX BETWEEN CCL17 AND M116 FAB Deposited 2017-07-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 24–94（71 aa） Fragment：UNP residues 24-94	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.4；293 K；15% PEG 3350, 0.2 M POTASSIUM SODIUM TARTRATE	Resolution 1.90 Å R-free 0.231
5WK3 CRYSTAL STRUCTURE OF THE COMPLEX BETWEEN CCL17 AND M116 FAB Deposited 2017-07-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 24–94（71 aa） Fragment：UNP residues 24-94	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.4；293 K；15% PEG 3350, 0.2 M POTASSIUM SODIUM TARTRATE	Resolution 1.90 Å R-free 0.231
5WK3 CRYSTAL STRUCTURE OF THE COMPLEX BETWEEN CCL17 AND M116 FAB Deposited 2017-07-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 24–94（71 aa） Fragment：UNP residues 24-94	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.4；293 K；15% PEG 3350, 0.2 M POTASSIUM SODIUM TARTRATE	Resolution 1.90 Å R-free 0.231
5WK3 CRYSTAL STRUCTURE OF THE COMPLEX BETWEEN CCL17 AND M116 FAB Deposited 2017-07-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 24–94（71 aa） Fragment：UNP residues 24-94	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.4；293 K；15% PEG 3350, 0.2 M POTASSIUM SODIUM TARTRATE	Resolution 1.90 Å R-free 0.231
7S4N Crystal structure of the tick evasin EVA-P974 complexed to human chemokine CCL17 Deposited 2021-09-09	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 24–94（71 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 3.5；291 K；0.1 M Na3 Cit 3.5 pH (Buffer) 3 M NaCl (Precipitant)	Resolution 1.65 Å R-free 0.237
7S4N Crystal structure of the tick evasin EVA-P974 complexed to human chemokine CCL17 Deposited 2021-09-09	Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 24–94（71 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 3.5；291 K；0.1 M Na3 Cit 3.5 pH (Buffer) 3 M NaCl (Precipitant)	Resolution 1.65 Å R-free 0.237
7SCV Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL17 Deposited 2021-09-29	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 24–94（71 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M Na Acet 4.6 pH (Buffer),2 M NaCl (Precipitant)	Resolution 2.01 Å R-free 0.251
8SKK Crystal Structure of the Tick Evasin EVA-AAM1001(L39P) Complexed to Human Chemokine CCL17 Deposited 2023-04-19	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 24–94（71 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；291 K；2M Ammonium sulfate, 0.1 M HEPES pH 7.0	Resolution 2.10 Å R-free 0.211

6 other PDB entries and 15 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CCL17_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–71； UniProt 24–94

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8fj2
Deposition date deposition_date	2022-12-19
Structure title title	Crystal Structure of the Tick Evasin EVA-AAM1001(C8) Complexed to Human Chemokine CCL17
Keywords keywords	Evasin, Chemokine-binding protein, ticks, CYTOKINE; CYTOKINE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	16.86 Å
Radius of gyration Rg (electron density) rg_electron	16.40 Å
Forward intensity I(0) i0	4746090.00
Molecular weight molecular_weight	15119.0 kDa
Excluded volume excluded_volume	18669 Å³
Envelope volume envelope_volume	22129 Å³
Hydration-shell volume shell_volume	12148 Å³
Envelope diameter envelope_diameter	57.5 Å
Shell Rg shell_rg	21.12 Å
Envelope Rg envelope_rg	16.75 Å
Shape Rg shape_rg	16.42 Å
Total Rg total_rg	17.20 Å
Total atoms total_atoms	2046
Residues n_residues	142
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	57.4 Å
Rg (real space) rg_real	16.93 Å
Rg uncertainty (real space) rg_real_error	0.42 Å
I(0) (real space) i0_real	4.7460e+06
I(0) uncertainty (real space) i0_real_error	5.5150e+04
Rg (reciprocal space) rg_reciprocal	16.92 Å
I(0) (reciprocal space) i0_reciprocal	4746000.0000
Solution quality estimate total_estimate	0.7863
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	18.9 Å
Skewness Skewness skewness	0.480
Kurtosis Kurtosis kurtosis	-0.168
Angular range angular_range	— – 0.4700 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	854600.0000
Real-space data points n_real_points	77
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.770; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.909; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Evasin P1243
Molecular weight formula_weight	11270.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	2089

GSTSARNHTEDNSTEYYDYEEARSACPARHLNNTNGTVLKLLGCHYFCNGTLSTAPDGYPCYNLTAQQVRTLTTYPNTSCAVGVCMKGTCVKNGTMEQCFKTP

来源 Source

来源生物 organism	Amblyomma americanum
通用名 common_name	Lone Star tick
NCBI Class编号 ncbi_taxonomy_id	6943
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	C-C motif chemokine 17
Molecular weight formula_weight	8096.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	43

▶

8. Citations (1)

▶

Unit-cell length a length_a	60.641 Å
Unit-cell length b length_b	62.536 Å
Unit-cell length c length_c	92.684 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	I 2 2 2
Space-group number int_tables_number	23
Crystal system crystal_system	orthorhombic

Resolution resolution	2.070 Å
Low-resolution limit resolution_low	43.530 Å
R factor r_factor	0.2140
R_work r_work	0.2130
R_free r_free	0.2307

fit	/app/data/saxs_computation/fj/8fj2/8fj2.fit
pddf	/app/data/pr_computation/fj/8fj2/8fj2.pr.out
profile	/app/data/saxs_computation/fj/8fj2/8fj2.dat

Crystal Structure of the Tick Evasin EVA-AAM1001(C8) Complexed to Human Chemokine CCL17

1. Protein Identity and Related Structures Protein Identity & Related Structures

Evasin P1243

State in the Current Structure

Other States of the Same Protein in the Database

C-C motif chemokine 17

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)