SAXSdb — 8fk9

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Evasin P991

Amblyomma cajennense

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain A； UniProt 29–136 Chain B； UniProt 29–136	Not recorded	C-C motif chemokine 16 × 2 （O15467）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；298 K；0.1 M HEPES 7 pH, 0.5 %v/v Jeff ED-2001, 1.1 M Na2 Malon	Resolution 2.70 Å R-free 0.266

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	EV991_AMBCJ
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–108； UniProt 29–136 Author chain B； PDBConstruct 1–108； UniProt 29–136

C-C motif chemokine 16

Homo sapiens

UniProt O15467

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain C； UniProt 23–120 Chain D； UniProt 23–120	Not recorded	Evasin P991 × 2 （A0A023FFD0）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；298 K；0.1 M HEPES 7 pH, 0.5 %v/v Jeff ED-2001, 1.1 M Na2 Malon	Resolution 2.70 Å R-free 0.266

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8FK9	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5LTL Structure of human chemokine CCL16 Deposited 2016-09-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 24–120（97 aa） Chain B 24–120（97 aa）	Not recorded	NA SODIUM ION × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.05 M sodium phosphate, 0.5 M sodium chloride, 10 % (v/v) glycerol, 1.6 M sodium citrate	Resolution 1.45 Å R-free 0.198
7SCT Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL16 Deposited 2021-09-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 23–120（98 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.26 M (NH4)2SO4 (Precipitant),0.1 M HEPES 7.5 pH (Buffer)	Resolution 1.84 Å R-free 0.210

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CCL16_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 3–100； UniProt 23–120 Author chain D； PDBConstruct 3–100； UniProt 23–120

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8fk9
Deposition date deposition_date	2022-12-21
Structure title title	Crystal Structure of the Tick Evasin EVA-ACA1001 Complexed to Human Chemokine CCL16
Keywords keywords	Evasin, Chemokine-binding protein, ticks, CYTOKINE; CYTOKINE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	23.33 Å
Radius of gyration Rg (electron density) rg_electron	22.74 Å
Forward intensity I(0) i0	17363900.00
Molecular weight molecular_weight	31139.0 kDa
Excluded volume excluded_volume	38700 Å³
Envelope volume envelope_volume	49370 Å³
Hydration-shell volume shell_volume	18830 Å³
Envelope diameter envelope_diameter	74.8 Å
Shell Rg shell_rg	28.82 Å
Envelope Rg envelope_rg	22.50 Å
Shape Rg shape_rg	22.76 Å
Total Rg total_rg	23.49 Å
Total atoms total_atoms	2174
Residues n_residues	296
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	73.5 Å
Rg (real space) rg_real	23.33 Å
Rg uncertainty (real space) rg_real_error	0.51 Å
I(0) (real space) i0_real	1.7360e+07
I(0) uncertainty (real space) i0_real_error	2.3410e+05
Rg (reciprocal space) rg_reciprocal	23.33 Å
I(0) (reciprocal space) i0_reciprocal	17360000.0000
Solution quality estimate total_estimate	0.9125
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	27.1 Å
Skewness Skewness skewness	0.263
Kurtosis Kurtosis kurtosis	-0.513
Angular range angular_range	— – 0.3400 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	1424000.0000
Real-space data points n_real_points	66
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.971; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.971; Smooth: 0.974

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Evasin P991
Molecular weight formula_weight	11940.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	2217

ENGEGTTQPDYDNSTDYYNYEDFKCTCPAPHLNNTNGTVMKPIGCYYTCNVTRCTAPDTYPCYNLTEHQAKNLTTSPTTLCAVGNCDHGICVPNGTKELCFKAPNLEE

来源 Source

来源生物 organism	Amblyomma cajennense
通用名 common_name	Cayenne tick
NCBI Class编号 ncbi_taxonomy_id	34607
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	C-C motif chemokine 16
Molecular weight formula_weight	11458.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

GPSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	43

▶

8. Citations (1)

▶

Unit-cell length a length_a	117.062 Å
Unit-cell length b length_b	122.801 Å
Unit-cell length c length_c	60.501 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	C 2 2 2
Space-group number int_tables_number	21
Crystal system crystal_system	orthorhombic

Resolution resolution	2.700 Å
Low-resolution limit resolution_low	42.370 Å
R factor r_factor	0.2534
R_work r_work	0.2528
R_free r_free	0.2661

fit	/app/data/saxs_computation/fk/8fk9/8fk9.fit
pddf	/app/data/pr_computation/fk/8fk9/8fk9.pr.out
profile	/app/data/saxs_computation/fk/8fk9/8fk9.dat

Crystal Structure of the Tick Evasin EVA-ACA1001 Complexed to Human Chemokine CCL16

1. Protein Identity and Related Structures Protein Identity & Related Structures

Evasin P991

State in the Current Structure

Other States of the Same Protein in the Database

C-C motif chemokine 16

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)