SAXSdb — 8fk9

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Evasin P991

Amblyomma cajennense

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	C-C motif chemokine 16 × 2 （O15467） water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EV991_AMBCJ
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–108； UniProt 29–136 Author chain B； PDBConstruct 1–108； UniProt 29–136

C-C motif chemokine 16

Homo sapiens

UniProt O15467

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Evasin P991 × 2 （A0A023FFD0） water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CCL16_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 3–100； UniProt 23–120 Author chain D； PDBConstruct 3–100； UniProt 23–120

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8fk9
Deposition date deposition_date	2022-12-21
Structure title title	Crystal Structure of the Tick Evasin EVA-ACA1001 Complexed to Human Chemokine CCL16
Keywords keywords	Evasin, Chemokine-binding protein, ticks, CYTOKINE; CYTOKINE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8fk9__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8fk9__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8fk9__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	23.33 Å
Rg (electron density)	22.74 Å
Total Rg	23.49 Å
Atom count	2174
Residues	296
Excluded volume	38700 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8fk9__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Evasin P991
Molecular weight formula_weight	11940.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	2217

ENGEGTTQPDYDNSTDYYNYEDFKCTCPAPHLNNTNGTVMKPIGCYYTCNVTRCTAPDTYPCYNLTEHQAKNLTTSPTTLCAVGNCDHGICVPNGTKELCFKAPNLEE

Source Source

Source organism organism	Amblyomma cajennense
Common name common_name	Cayenne tick
NCBI taxonomy ID ncbi_taxonomy_id	34607
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	C-C motif chemokine 16
Molecular weight formula_weight	11458.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

GPSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	43

▶

Unit-cell length a length_a	117.062 Å
Unit-cell length b length_b	122.801 Å
Unit-cell length c length_c	60.501 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	C 2 2 2
Space-group number int_tables_number	21
Crystal system crystal_system	orthorhombic

Resolution resolution	2.700 Å
Low-resolution limit resolution_low	42.370 Å
R factor r_factor	0.2534
R_work r_work	0.2528
R_free r_free	0.2661

Crystal Structure of the Tick Evasin EVA-ACA1001 Complexed to Human Chemokine CCL16

1. Protein Identity and Related Structures Protein Identity & Related Structures

Evasin P991

State in the Current Structure

Other States of the Same Protein in the Database

C-C motif chemokine 16

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8fk9__assembly_1__model_1

8fk9__assembly_1__model_1 | I(q)

8fk9__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

7. Citations (1)

Crystal Structure of the Tick Evasin EVA-ACA1001 Complexed to Human Chemokine CCL16

1. Protein Identity and Related Structures Protein Identity & Related Structures

Evasin P991

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

C-C motif chemokine 16

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8fk9__assembly_1__model_1

8fk9__assembly_1__model_1 | I(q)

8fk9__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

7. Citations (1)