SAXSdb — 8fxw

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

CPXV040 protein

Cowpox virus (Brighton Red)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	T-lymphocyte activation antigen CD80 × 6 （P33681） 2-acetamido-2-deoxy-beta-D-glucopyranose × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8QN22_CWPXB
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–206； UniProt 18–220 Author chain B； PDBConstruct 4–206； UniProt 18–220 Author chain D； PDBConstruct 4–206； UniProt 18–220 Author chain F； PDBConstruct 4–206； UniProt 18–220 Author chain I； PDBConstruct 4–206； UniProt 18–220 Author chain K； PDBConstruct 4–206； UniProt 18–220

T-lymphocyte activation antigen CD80

Homo sapiens

UniProt P33681

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	CPXV040 protein × 6 （Q8QN22） 2-acetamido-2-deoxy-beta-D-glucopyranose × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CD80_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–201； UniProt 35–235 Author chain E； PDBConstruct 1–201； UniProt 35–235 Author chain G； PDBConstruct 1–201； UniProt 35–235 Author chain H； PDBConstruct 1–201； UniProt 35–235 Author chain J； PDBConstruct 1–201； UniProt 35–235 Author chain L； PDBConstruct 1–201； UniProt 35–235

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8fxw
Deposition date deposition_date	2023-01-25
Structure title title	Cryo-EM structure of cowpox virus M2 in complex with human B7.1 (hexameric ring)
Keywords keywords	;poxvirus M2 protein, OPG038, T-cell costimulation, poxviral immune evasion domain PIE, B7.1, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, VIRAL PROTEIN ;; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8fxw__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8fxw__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8fxw__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	55.23 Å
Rg (electron density)	55.27 Å
Total Rg	55.50 Å
Atom count	29916
Residues	1854
Excluded volume	269440 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8fxw__assembly_1__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	CPXV040 protein
Molecular weight formula_weight	25809.9 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,D,F,I,K
Atom count atom_count	29916

KPEAEYKNTICPPRQDYRYWYFAAELTIGVNYDINSTIMGECHMSESYIDRNANIVLTGYGLEINMTIMDTDQRFVAAAEGVGKDNKLSVLLFTTQRLDKVHHNISVTITCMEMNCGTTKYDSDLPESIHHKSSCDITINGSCVTCVNLETDPTKINPHYLHPKDKYLYRNSEYGMRGSYGVTFMDELNQCFLDIKEVSYDICYREGSTGGSENLYFQGHHHHHH

Source Source

Source organism organism	Cowpox virus (Brighton Red)
NCBI taxonomy ID ncbi_taxonomy_id	265872
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	T-lymphocyte activation antigen CD80
Molecular weight formula_weight	22993.1 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,C,E,G,J,L

VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTAK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	syn
Copy count entity_count	18

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	2.70 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	674730

Cryo-EM structure of cowpox virus M2 in complex with human B7.1 (hexameric ring)

1. Protein Identity and Related Structures Protein Identity & Related Structures

CPXV040 protein

State in the Current Structure

Other States of the Same Protein in the Database

T-lymphocyte activation antigen CD80

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8fxw__assembly_1__model_1

8fxw__assembly_1__model_1 | I(q)

8fxw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

7. Citations (1)

Cryo-EM structure of cowpox virus M2 in complex with human B7.1 (hexameric ring)

1. Protein Identity and Related Structures Protein Identity & Related Structures

CPXV040 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T-lymphocyte activation antigen CD80

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8fxw__assembly_1__model_1

8fxw__assembly_1__model_1 | I(q)

8fxw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

7. Citations (1)