SAXSdb — 8gt3

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Actin, alpha cardiac muscle 1

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 3–377	Mutation：P109A Non-standard monomer：Yes (specific site not provided by mmCIF)	Actin-binding protein fragmin P × 1 （Q94707） ADP ADENOSINE-5'-DIPHOSPHATE × 1 PO4 PHOSPHATE ION × 3 MG MAGNESIUM ION × 1 EDO 1,2-ETHANEDIOL × 4 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；PEG3350, Disodium Hydrogenphosphate, HEPES	Resolution 1.50 Å R-free 0.196

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8GT3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8GSU Crystal structure of human cardiac alpha actin (WT_ADP-Pi) in complex with fragmin F1 domain Deposited 2022-09-07	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 3–377（375 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	ADP ADENOSINE-5'-DIPHOSPHATE × 1 PO4 PHOSPHATE ION × 3 MG MAGNESIUM ION × 1 EDO 1,2-ETHANEDIOL × 3 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；PEG3350, Disodium Hydrogenphosphate, HEPES	Resolution 1.50 Å R-free 0.191
8GSW Crystal structure of human cardiac alpha actin A108G mutant (AMPPNP state) in complex with fragmin F1 domain Deposited 2022-09-07	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 3–377（375 aa）	Mutation：A108G Non-standard monomer：Yes (specific site not provided by mmCIF)	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 MG MAGNESIUM ION × 1 PO4 PHOSPHATE ION × 1 EDO 1,2-ETHANEDIOL × 6 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；PEG3350, Disodium Hydrogenphosphate, HEPES	Resolution 1.40 Å R-free 0.196
8GT1 Crystal structure of human cardiac alpha actin A108G mutant (ADP-Pi state) in complex with fragmin F1 domain Deposited 2022-09-07	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 3–377（375 aa）	Mutation：A108G Non-standard monomer：Yes (specific site not provided by mmCIF)	ADP ADENOSINE-5'-DIPHOSPHATE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 PO4 PHOSPHATE ION × 3 MG MAGNESIUM ION × 1 EDO 1,2-ETHANEDIOL × 3 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；PEG3350, Disodium Hydrogenphosphate, HEPES	Resolution 1.35 Å R-free 0.202
8GT2 Crystal structure of human cardiac alpha actin P109A mutant (AMPPNP state) in complex with fragmin F1 domain Deposited 2022-09-07	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 3–377（375 aa）	Mutation：P109A Non-standard monomer：Yes (specific site not provided by mmCIF)	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 MG MAGNESIUM ION × 1 EDO 1,2-ETHANEDIOL × 6 PO4 PHOSPHATE ION × 2 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；PEG3350, Disodium Hydrogenphosphate, HEPES	Resolution 1.50 Å R-free 0.203
8GT4 Crystal structure of human cardiac alpha actin Q137A mutant (AMPPNP state) in complex with fragmin F1 domain Deposited 2022-09-07	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 3–377（375 aa）	Mutation：Q137A Non-standard monomer：Yes (specific site not provided by mmCIF)	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 MG MAGNESIUM ION × 1 EDO 1,2-ETHANEDIOL × 2 PO4 PHOSPHATE ION × 2 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；PEG3350, Disodium Hydrogenphosphate, HEPES	Resolution 1.55 Å R-free 0.209
8GT5 Crystal structure of human cardiac alpha actin Q137A mutant (ADP-Pi state) in complex with fragmin F1 domain Deposited 2022-09-07	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 3–377（375 aa）	Mutation：Q137A Non-standard monomer：Yes (specific site not provided by mmCIF)	ADP ADENOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1 PO4 PHOSPHATE ION × 3 EDO 1,2-ETHANEDIOL × 3 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；PEG3350, Disodium Hydrogenphosphate, HEPES	Resolution 1.40 Å R-free 0.185
8ZB7 Human left ventricle ATM complex Deposited 2024-04-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 7–377（371 aa） Chain B 7–377（371 aa） Chain C 7–377（371 aa） Chain D 7–377（371 aa） Chain E 7–377（371 aa） Chain F 7–377（371 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.19 Å
8ZI9 Human left ventricle actin and myosin complex Deposited 2024-05-13	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 7–377（371 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.08 Å
8ZJ1 Human left ventricle F-actin Deposited 2024-05-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 5 PDB declaration: pentameric	Chain A 7–377（371 aa） Chain C 7–377（371 aa） Chain D 7–377（371 aa） Chain E 7–377（371 aa） Chain F 7–377（371 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.25 Å
9B3Q The structure of the human cardiac F-actin mutant A331P Deposited 2024-03-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 1–377（377 aa） Chain D 1–377（377 aa） Chain E 1–377（377 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 3 ADP ADENOSINE-5'-DIPHOSPHATE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 8；2 mmolL-1 Tris (pH 8), 0.2 mmolL-1 CaCl2, 0.2 mmolL-1 ATP, 0.5 mmolL-1 b-mercaptoethanol, 0.002% NaN3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9B3R The structure of human cardiac F-actin Deposited 2024-03-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 1–377（377 aa） Chain D 1–377（377 aa） Chain E 1–377（377 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 3 ADP ADENOSINE-5'-DIPHOSPHATE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 8；2 mmolL-1 Tris (pH 8), 0.2 mmolL-1 CaCl2, 0.2 mmolL-1 ATP, 0.5 mmolL-1 b-mercaptoethanol, 0.002% NaN3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
9BPH CRYO-EM STRUCTURE OF CARDIAC MUSCLE ALPHA-ACTIN M305L HCM MUTANT Deposited 2024-05-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 3–377（375 aa） Chain B 3–377（375 aa） Chain C 3–377（375 aa） Chain D 3–377（375 aa）	Mutation：M305L Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：M305L Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：M305L Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：M305L Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.12 Å
9BPM CRYO-EM STRUCTURE OF CARDIAC MUSCLE ALPHA-ACTIN A331P HCM MUTANT Deposited 2024-05-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 3–377（375 aa） Chain B 3–377（375 aa） Chain C 3–377（375 aa） Chain D 3–377（375 aa）	Mutation：A331P Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：A331P Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：A331P Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：A331P Non-standard monomer：Yes (specific site not provided by mmCIF)	ADP ADENOSINE-5'-DIPHOSPHATE × 4 MG MAGNESIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.42 Å
9ZBL Helical Reconstruction of the Human Cardiac F-Actin-Tropomyosin Complex Deposited 2025-11-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain A 1–377（377 aa） Chain B 1–377（377 aa） Chain C 1–377（377 aa） Chain D 1–377（377 aa） Chain E 1–377（377 aa） Chain F 1–377（377 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 6 MG MAGNESIUM ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE；Blotting was performed with a blot force of 3 and a blot time of 3 s.	Resolution 2.79 Å
9ZBP Helical Reconstruction of the Complex of Pseudo-Acetylated Human Cardiac Actin (K326/328Q) and Tropomyosin Deposited 2025-11-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain A 1–377（377 aa） Chain B 1–377（377 aa） Chain C 1–377（377 aa） Chain D 1–377（377 aa） Chain E 1–377（377 aa） Chain F 1–377（377 aa）	Mutation：K326Q, K328Q Mutation：K326Q, K328Q Mutation：K326Q, K328Q Mutation：K326Q, K328Q Mutation：K326Q, K328Q Mutation：K326Q, K328Q	ADP ADENOSINE-5'-DIPHOSPHATE × 6 MG MAGNESIUM ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE；Blotting was performed with a blot force of 3 and a blot time of 3 s.	Resolution 3.12 Å

15 other PDB entries and 15 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ACTC_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 17–391； UniProt 3–377

Actin-binding protein fragmin P

Physarum polycephalum

UniProt Q94707

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 1–160	Not recorded	Actin, alpha cardiac muscle 1 × 1 （P68032） ADP ADENOSINE-5'-DIPHOSPHATE × 1 PO4 PHOSPHATE ION × 3 MG MAGNESIUM ION × 1 EDO 1,2-ETHANEDIOL × 4 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；PEG3350, Disodium Hydrogenphosphate, HEPES	Resolution 1.50 Å R-free 0.196

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8GT3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6KWZ Crystal structure of fragmin F3 domain with calcium ion Deposited 2019-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 276–371（96 aa） Chain B 276–371（96 aa）	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；100mM MES-NaOH (pH 6.0), 20% PEG 3350	Resolution 1.55 Å R-free 0.216
6LJC Crystal structure of fragmin F2-F3 domains (calcium and magnesium condition) Deposited 2019-12-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 162–371（210 aa）	Not recorded	CA CALCIUM ION × 2 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 SO4 SULFATE ION × 1 CL CHLORIDE ION × 1 GOL GLYCEROL × 2 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；PEG3350, ammonium sulphate, calcium chloride, magnesium chloride	Resolution 1.85 Å R-free 0.203
6LJD Crystal structure of fragmin F2-F3 domains (calcium condition) Deposited 2019-12-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 162–371（210 aa）	Not recorded	CA CALCIUM ION × 3 SO4 SULFATE ION × 1 GOL GLYCEROL × 1 CL CHLORIDE ION × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；PEG3350, ammonium sulphate, calcium chloride	Resolution 2.15 Å R-free 0.219
7W4Z Crystal structure of fragmin domain-1 in complex with actin (AMPPNP-form) Deposited 2021-11-29	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–160（160 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 MG MAGNESIUM ION × 1 PO4 PHOSPHATE ION × 2 EDO 1,2-ETHANEDIOL × 3 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；50 mM Na2HPO4, 19% PEG3350	Resolution 1.15 Å R-free 0.158
7W50 Crystal structure of fragmin domain-1 in complex with actin (ADP-Pi-form) Deposited 2021-11-29	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–160（160 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 PO4 PHOSPHATE ION × 3 MG MAGNESIUM ION × 1 EDO 1,2-ETHANEDIOL × 3 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；100 mM Na2HPO4, 18% PEG3350	Resolution 1.15 Å R-free 0.162
7W51 Crystal structure of fragmin domain-1 in complex with actin (ADP-form) Deposited 2021-11-29	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–160（160 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1 EDO 1,2-ETHANEDIOL × 5 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M HEPES-NaOH, pH 8.0, 16% PEG3350	Resolution 1.20 Å R-free 0.176
7W52 Crystal structure of fragmin domain-1 (15-160) in complex with actin Deposited 2021-11-29	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 15–160（146 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 1 CA CALCIUM ION × 3 ACT ACETATE ION × 3 NA SODIUM ION × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M sodium acetate, pH 4.5, 0.1 M calcium acetate, and 7% PEG3350	Resolution 2.00 Å R-free 0.246
7W52 Crystal structure of fragmin domain-1 (15-160) in complex with actin Deposited 2021-11-29	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 15–160（146 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 1 CA CALCIUM ION × 3 ACT ACETATE ION × 1 NA SODIUM ION × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M sodium acetate, pH 4.5, 0.1 M calcium acetate, and 7% PEG3350	Resolution 2.00 Å R-free 0.246
7W52 Crystal structure of fragmin domain-1 (15-160) in complex with actin Deposited 2021-11-29	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 15–160（146 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 1 CA CALCIUM ION × 3 NA SODIUM ION × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M sodium acetate, pH 4.5, 0.1 M calcium acetate, and 7% PEG3350	Resolution 2.00 Å R-free 0.246
7W52 Crystal structure of fragmin domain-1 (15-160) in complex with actin Deposited 2021-11-29	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 15–160（146 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 1 CA CALCIUM ION × 3 NA SODIUM ION × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M sodium acetate, pH 4.5, 0.1 M calcium acetate, and 7% PEG3350	Resolution 2.00 Å R-free 0.246
7YNE Crystal structure of fragmin domain-1 (1-160) in complex with G-form actin Deposited 2022-07-30	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–160（160 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 CA CALCIUM ION × 3 ACT ACETATE ION × 3 NA SODIUM ION × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M sodium acetate, pH 5.0, 0.1 M calcium acetate, and 12% PEG4000	Resolution 2.70 Å R-free 0.308
7YNE Crystal structure of fragmin domain-1 (1-160) in complex with G-form actin Deposited 2022-07-30	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–160（160 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 CA CALCIUM ION × 3 ACT ACETATE ION × 1 NA SODIUM ION × 1 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M sodium acetate, pH 5.0, 0.1 M calcium acetate, and 12% PEG4000	Resolution 2.70 Å R-free 0.308
7YNE Crystal structure of fragmin domain-1 (1-160) in complex with G-form actin Deposited 2022-07-30	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–160（160 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M sodium acetate, pH 5.0, 0.1 M calcium acetate, and 12% PEG4000	Resolution 2.70 Å R-free 0.308
7YNE Crystal structure of fragmin domain-1 (1-160) in complex with G-form actin Deposited 2022-07-30	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1–160（160 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M sodium acetate, pH 5.0, 0.1 M calcium acetate, and 12% PEG4000	Resolution 2.70 Å R-free 0.308
8GSU Crystal structure of human cardiac alpha actin (WT_ADP-Pi) in complex with fragmin F1 domain Deposited 2022-09-07	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–160（160 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 PO4 PHOSPHATE ION × 3 MG MAGNESIUM ION × 1 EDO 1,2-ETHANEDIOL × 3 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；PEG3350, Disodium Hydrogenphosphate, HEPES	Resolution 1.50 Å R-free 0.191
8GSW Crystal structure of human cardiac alpha actin A108G mutant (AMPPNP state) in complex with fragmin F1 domain Deposited 2022-09-07	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–160（160 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 MG MAGNESIUM ION × 1 PO4 PHOSPHATE ION × 1 EDO 1,2-ETHANEDIOL × 6 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；PEG3350, Disodium Hydrogenphosphate, HEPES	Resolution 1.40 Å R-free 0.196
8GT1 Crystal structure of human cardiac alpha actin A108G mutant (ADP-Pi state) in complex with fragmin F1 domain Deposited 2022-09-07	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–160（160 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 PO4 PHOSPHATE ION × 3 MG MAGNESIUM ION × 1 EDO 1,2-ETHANEDIOL × 3 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；PEG3350, Disodium Hydrogenphosphate, HEPES	Resolution 1.35 Å R-free 0.202
8GT2 Crystal structure of human cardiac alpha actin P109A mutant (AMPPNP state) in complex with fragmin F1 domain Deposited 2022-09-07	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–160（160 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 MG MAGNESIUM ION × 1 EDO 1,2-ETHANEDIOL × 6 PO4 PHOSPHATE ION × 2 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；PEG3350, Disodium Hydrogenphosphate, HEPES	Resolution 1.50 Å R-free 0.203
8GT4 Crystal structure of human cardiac alpha actin Q137A mutant (AMPPNP state) in complex with fragmin F1 domain Deposited 2022-09-07	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–160（160 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 MG MAGNESIUM ION × 1 EDO 1,2-ETHANEDIOL × 2 PO4 PHOSPHATE ION × 2 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；PEG3350, Disodium Hydrogenphosphate, HEPES	Resolution 1.55 Å R-free 0.209
8GT5 Crystal structure of human cardiac alpha actin Q137A mutant (ADP-Pi state) in complex with fragmin F1 domain Deposited 2022-09-07	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–160（160 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1 PO4 PHOSPHATE ION × 3 EDO 1,2-ETHANEDIOL × 3 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；PEG3350, Disodium Hydrogenphosphate, HEPES	Resolution 1.40 Å R-free 0.185
9L2N Crystal structure of Cytochalasin D bound to a filamentous conformation actin Deposited 2024-12-17	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–160（160 aa）	Mutation：N13A	ADP ADENOSINE-5'-DIPHOSPHATE × 1 PO4 PHOSPHATE ION × 3 MG MAGNESIUM ION × 1 CY9 (3S,3aR,4S,6S,6aR,7E,10S,12R,13E,15R,15aR)-3-benzyl-6,12-dihydroxy-4,10,12-trimethyl-5-methylidene-1,11-dioxo-2,3,3a,4,5,6,6a,9,10,11,12,15-dodecahydro-1H-cycloundeca[d]isoindol-15-yl acetate × 1 CA CALCIUM ION × 2 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；17% (w/v) PEG3350 and 20 mM Na2HPO4	Resolution 1.70 Å R-free 0.204

15 other PDB entries and 21 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q94707_PHYPO
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 3–162； UniProt 1–160

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8gt3
Deposition date deposition_date	2022-09-07
Structure title title	Crystal structure of human cardiac alpha actin P109A mutant (ADP-Pi state) in complex with fragmin F1 domain
Keywords keywords	actin dynamics, ATP hydrolysis, mutagenesis, MD simulation, CONTRACTILE PROTEIN; CONTRACTILE PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	25.14 Å
Radius of gyration Rg (electron density) rg_electron	24.16 Å
Forward intensity I(0) i0	57608200.00
Molecular weight molecular_weight	58609.0 kDa
Excluded volume excluded_volume	73024 Å³
Envelope volume envelope_volume	85881 Å³
Hydration-shell volume shell_volume	29271 Å³
Envelope diameter envelope_diameter	88.9 Å
Shell Rg shell_rg	32.00 Å
Envelope Rg envelope_rg	24.72 Å
Shape Rg shape_rg	24.18 Å
Total Rg total_rg	24.96 Å
Total atoms total_atoms	4118
Residues n_residues	517
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	85.8 Å
Rg (real space) rg_real	25.11 Å
Rg uncertainty (real space) rg_real_error	0.59 Å
I(0) (real space) i0_real	5.7610e+07
I(0) uncertainty (real space) i0_real_error	8.1950e+05
Rg (reciprocal space) rg_reciprocal	25.12 Å
I(0) (reciprocal space) i0_reciprocal	57610000.0000
Solution quality estimate total_estimate	0.8752
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	28.6 Å
Skewness Skewness skewness	0.348
Kurtosis Kurtosis kurtosis	-0.231
Angular range angular_range	— – 0.3150 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	14970000.0000
Real-space data points n_real_points	64
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.803; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.970; Smooth: 0.994

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Actin, alpha cardiac muscle 1
Molecular weight formula_weight	43618.5 kDa
Mutation mutation	P109A
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	5098

MGWSHPQFEKGGIEGRDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAALNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Spodoptera frugiperda

Entity 2 Entity 2 polymer

Description description	Actin-binding protein fragmin P
Molecular weight formula_weight	18253.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

GPMQKQKEYNIADSNIANLGTELEKKVKLEASQHEDAWKGAGKQVGVEIWRIQQFKVVPVPKKHHGSFYTGDSYIVLSTYHPKTNPDKLAYDVHFWLGAFTTQDEAGTAAYKTVELDDYLGGLPVQYREVQGYESERFLSLFPKGGLRILDGGVETGFHHVE

来源 Source

来源生物 organism	Physarum polycephalum
NCBI Class编号 ncbi_taxonomy_id	5791
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 5 Entity 5 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 7 Entity 7 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 8 Entity 8 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	761

▶

8. Citations (1)

▶

Unit-cell length a length_a	57.171 Å
Unit-cell length b length_b	91.108 Å
Unit-cell length c length_c	115.142 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.500 Å
Low-resolution limit resolution_low	45.550 Å
R factor r_factor	0.1662
R_work r_work	0.1646
R_free r_free	0.1958

fit	/app/data/saxs_computation/gt/8gt3/8gt3.fit
pddf	/app/data/pr_computation/gt/8gt3/8gt3.pr.out
profile	/app/data/saxs_computation/gt/8gt3/8gt3.dat

Crystal structure of human cardiac alpha actin P109A mutant (ADP-Pi state) in complex with fragmin F1 domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

Actin, alpha cardiac muscle 1

State in the Current Structure

Other States of the Same Protein in the Database

Actin-binding protein fragmin P

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)