8ihz

FACTOR INHIBITING HIF-1 ALPHA in complex with (5-(1-(3-(4-chlorophenyl)propyl)-1H-1,2,3-triazol-4-yl)-3-hydroxypicolinoyl)glycine

Method: X-RAY DIFFRACTION D_max: 70.6 Å Quality: REASONABLE

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hypoxia-inducible factor 1-alpha inhibitor

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain A； UniProt 1–349	Not recorded	SO4 SULFATE ION × 14 ZN ZINC ION × 1 P1X 2-[[5-[1-[3-(4-chlorophenyl)propyl]-1,2,3-triazol-4-yl]-3-oxidanyl-pyridin-2-yl]carbonylamino]ethanoic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；1.6 M AMMONIUM SULPHATE, 6% PEG 400, 0.1 M HEPES	Resolution 2.22 Å R-free 0.261

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8IHZ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1H2N Factor Inhibiting HIF-1 alpha Deposited 2002-08-12	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	FE2 FE (II) ION × 2 AKG 2-OXOGLUTARIC ACID × 2 SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；1.2M AMMONIUM SULPHATE, 4% PEG400, 0.1M HEPES PH7.5 ARGON ATMOSPHERE, 11MG/ML PROTEIN WITH 1MM FE(II), 2.5MM AKG AND 2.5MM PEPTIDE (SEE REMARK 400), pH 7.50	Resolution 2.84 Å R-free 0.257
1IZ3 Dimeric structure of FIH (Factor inhibiting HIF) Deposited 2002-09-19	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；0.4M Lithium sulfate, 20% PEG 4000, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.80 Å R-free 0.277
1MZE Human Factor Inhibiting HIF (FIH1) Deposited 2002-10-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	FE2 FE (II) ION × 2 TAR D(-)-TARTARIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9.6；294 K；potassium tartrate, CAPSO, glycerol, pH 9.6, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 2.20 Å R-free 0.237
1MZE Human Factor Inhibiting HIF (FIH1) Deposited 2002-10-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	FE2 FE (II) ION × 2 TAR D(-)-TARTARIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9.6；294 K；potassium tartrate, CAPSO, glycerol, pH 9.6, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 2.20 Å R-free 0.237
1MZF Human Factor inhibiting HIF (FIH1) in Complex with 2-oxoglutarate Deposited 2002-10-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	FE2 FE (II) ION × 2 AKG 2-OXOGLUTARIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9.6；294 K；potassium tartrate, CAPSO, iron(II) sulfate, 2-oxoglutarate, glycerol, pH 9.6, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 2.40 Å R-free 0.244
1MZF Human Factor inhibiting HIF (FIH1) in Complex with 2-oxoglutarate Deposited 2002-10-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	FE2 FE (II) ION × 2 AKG 2-OXOGLUTARIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9.6；294 K；potassium tartrate, CAPSO, iron(II) sulfate, 2-oxoglutarate, glycerol, pH 9.6, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 2.40 Å R-free 0.244
1YCI Factor inhibiting HIF-1 alpha in complex with N-(carboxycarbonyl)-D-phenylalanine Deposited 2004-12-22	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	FE2 FE (II) ION × 2 SO4 SULFATE ION × 6 NDF N-(CARBOXYCARBONYL)-D-PHENYLALANINE × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；1.2M AMMONIUM SULPHATE, 4% PEG400, 0.1M HEPES PH7.5 ARGON ATMOSPHERE, 28MG/ML PROTEIN WITH 1MM FE(II), 10MM N-(CARBOXYCARBONYL)-D-PHENYLALANINE, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.70 Å R-free 0.244
2CGN FACTOR INHIBITING HIF-1 ALPHA with succinate Deposited 2006-03-09	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–349（349 aa）	Not recorded	FE FE (III) ION × 1 SIN SUCCINIC ACID × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；1.25M AMMONIUM SULFATE, 100MM HEPES PH7.5, 6% PEG400, 1MM IRON (II) SULFATE, 20MM SUCCINIC ACID, pH 7.50	Resolution 2.40 Å R-free 0.263
2CGO FACTOR INHIBITING HIF-1 ALPHA with fumarate Deposited 2006-03-09	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–349（349 aa）	Not recorded	FE FE (III) ION × 1 FUM FUMARIC ACID × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；1.25M AMMONIUM SULFATE, 100MM HEPES PH7.5, 6% PEG400, 1MM IRON (II) SULFATE, 20MM FUMARIC ACID, pH 7.50	Resolution 2.30 Å R-free 0.237
2ILM Factor Inhibiting HIF-1 Alpha D201A Mutant in Complex with FE(II), Alpha-Ketoglutarate and HIF-1 Alpha 35mer Deposited 2006-10-03	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–349（349 aa）	Mutation：D201A	FE2 FE (II) ION × 2 SO4 SULFATE ION × 4 BCT BICARBONATE ION × 2 AKG 2-OXOGLUTARIC ACID × 2 GOL GLYCEROL × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；1.6M AMMONIUM SULPHATE, 6% PEG400, 0.1M HEPES PH7.5 ARGON ATMOSPHERE, 14MG/ML PROTEIN WITH 1MM FE(II)SO4, 1MM ALPHA-KETOGLUTARATE, 1MM HIF-1ALPHA PEPTIDE, VAPOR DIFFUSION, HANGING DROP, TEMPERATURE 298.0K, pH 7.50	Resolution 2.30 Å R-free 0.267
2W0X FACTOR INHIBITING HIF-1 ALPHA WITH PYRIDINE 2,4 DICARBOXYLIC ACID Deposited 2008-10-10	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	FE2 FE (II) ION × 2 PD2 PYRIDINE-2,4-DICARBOXYLIC ACID × 2 SO4 SULFATE ION × 6 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；1.6M AMMONIUM SULFATE, 0.1M HEPES PH 7.5, 5% PEG400, 1MM FESO4, 2MM SUBSTRATE	Resolution 2.12 Å R-free 0.262
2WA3 FACTOR INHIBITING HIF-1 ALPHA WITH 2-(3-hydroxyphenyl)-2-oxoacetic acid Deposited 2009-02-02	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	FE2 FE (II) ION × 2 A29 2-(3-HYDROXYPHENYL)-2-OXO-ETHANOIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；1.5 M AMMONIUM SULFATE, 100MM HEPES PH 7.5, 3% PEG400, 1MM FESO4, 28MG/ML PROTEIN, 10MM SUBSTRATE	Resolution 2.50 Å R-free 0.246
2WA4 FACTOR INHIBITING HIF-1 ALPHA WITH N,3-dihydroxybenzamide Deposited 2009-02-02	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	FE2 FE (II) ION × 2 069 N,3-DIHYDROXYBENZAMIDE × 4 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；1.5M AMMONIUM SULFATE, 100MM HEPES PH 7.5, 3% PEG400, 1MM FESO4, 28MB/ML PROTEIN, 10MM SUBSTRATE. CRYSTALS ARE DEEP RED.	Resolution 2.50 Å R-free 0.267
2XUM FACTOR INHIBITING HIF (FIH) Q239H MUTANT IN COMPLEX WITH ZN(II), NOG AND ASP-SUBSTRATE PEPTIDE (20-MER) Deposited 2010-10-19	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–349（349 aa）	Mutation：YES	ZN ZINC ION × 2 OGA N-OXALYLGLYCINE × 2 SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；1.6M AMMONIUM SULPHATE, 6% PEG400, 0.1M HEPES PH7.5, VAPOR DIFFUSION, SITTING DROP	Resolution 2.20 Å R-free 0.222
2XUM FACTOR INHIBITING HIF (FIH) Q239H MUTANT IN COMPLEX WITH ZN(II), NOG AND ASP-SUBSTRATE PEPTIDE (20-MER) Deposited 2010-10-19	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Mutation：YES	ZN ZINC ION × 1 OGA N-OXALYLGLYCINE × 1 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；1.6M AMMONIUM SULPHATE, 6% PEG400, 0.1M HEPES PH7.5, VAPOR DIFFUSION, SITTING DROP	Resolution 2.20 Å R-free 0.222
2Y0I FACTOR INHIBITING HIF-1 ALPHA IN COMPLEX WITH TANKYRASE-2 (TNKS2) FRAGMENT PEPTIDE (21-MER) Deposited 2010-12-02	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–349（349 aa）	Not recorded	FE2 FE (II) ION × 2 AKG 2-OXOGLUTARIC ACID × 2 SO4 SULFATE ION × 6 GOL GLYCEROL × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；1.6M AMMONIUM SULPHATE, 6% PEG 400, 0.1M HEPES PH 7.5 .	Resolution 2.28 Å R-free 0.248
2YC0 FACTOR INHIBITING HIF-1 ALPHA IN COMPLEX WITH R-2-HYDROXYGLUTARATE Deposited 2011-03-10	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	FE2 FE (II) ION × 2 2HG (2R)-2-hydroxypentanedioic acid × 2 GOL GLYCEROL × 6 SO4 SULFATE ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.1M HEPES PH7.5, 1.6M AMMONIUM SULFATE, 6% PEG400, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 293K	Resolution 2.15 Å R-free 0.253
2YDE FACTOR INHIBITING HIF-1 ALPHA IN COMPLEX WITH S-2-HYDROXYGLUTARATE Deposited 2011-03-18	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	FE FE (III) ION × 2 S2G (2S)-2-HYDROXYPENTANEDIOIC ACID × 4 GOL GLYCEROL × 4 SO4 SULFATE ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.1M HEPES PH7.5, 1.6M AMMONIUM SULPHATE, 6% PEG400, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 293K	Resolution 2.28 Å R-free 0.243
3D8C Factor inhibiting HIF-1 alpha D201G mutant in complex with ZN(II), alpha-ketoglutarate and HIF-1 alpha 19mer Deposited 2008-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 11–349（339 aa）	Mutation：D201G	ZN ZINC ION × 2 SO4 SULFATE ION × 4 AKG 2-OXOGLUTARIC ACID × 2 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；1.6M AMMONIUM SULPHATE, 6% PEG400, 0.1M HEPES PH7.5, 24MG/ML PROTEIN WITH 1MM FE(II)SO4, 1MM ALPHA-KETOGLUTARATE, 1MM HIF-1ALPHA PEPTIDE, VAPOR DIFFUSION, HANGING DROP, TEMPERATURE 298.0K, PH 7.50	Resolution 2.10 Å R-free 0.256
3D8C Factor inhibiting HIF-1 alpha D201G mutant in complex with ZN(II), alpha-ketoglutarate and HIF-1 alpha 19mer Deposited 2008-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 11–349（339 aa）	Mutation：D201G	ZN ZINC ION × 1 SO4 SULFATE ION × 2 AKG 2-OXOGLUTARIC ACID × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；1.6M AMMONIUM SULPHATE, 6% PEG400, 0.1M HEPES PH7.5, 24MG/ML PROTEIN WITH 1MM FE(II)SO4, 1MM ALPHA-KETOGLUTARATE, 1MM HIF-1ALPHA PEPTIDE, VAPOR DIFFUSION, HANGING DROP, TEMPERATURE 298.0K, PH 7.50	Resolution 2.10 Å R-free 0.256
3KCX Factor inhibiting HIF-1 alpha in complex with Clioquinol Deposited 2009-10-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 15–349（335 aa） Fragment：residues 15-349	Not recorded	FE2 FE (II) ION × 2 SO4 SULFATE ION × 4 GOL GLYCEROL × 6 CQL 5-chloro-7-iodoquinolin-8-ol × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；1.6M ammonium sulfate, 2% polyethyleneglycol 400, 0.1M Tris-HCl, pH 7.5, vapor diffusion, hanging drop, temperature 293K	Resolution 2.60 Å R-free 0.292
3KCY Factor inhibiting HIF-1 alpha in complex with 8-hydroxyquinoline Deposited 2009-10-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 15–349（335 aa） Fragment：residues 15-349	Not recorded	FE2 FE (II) ION × 2 SO4 SULFATE ION × 4 HQY quinolin-8-ol × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；1.6M ammonium sulfate, 2% polyethyleneglycol 400, 0.1M Tris-HCl, pH 7.5, vapor diffusion, hanging drop, temperature 293K	Resolution 2.59 Å R-free 0.335
3OD4 Crystal Structure of Factor Inhibiting HIF-1 Alpha Complexed with Inhibitor Deposited 2010-08-10	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	ZN ZINC ION × 2 8XQ 8-hydroxyquinoline-5-carboxylic acid × 2 SO4 SULFATE ION × 6 GOL GLYCEROL × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；1.75M AMMONIUM SULFATE, 0.1M HEPES PH 7.5, 2% PEG 400, 2MM ZNCL2, 0.1MM LIGAND , VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.20 Å R-free 0.212
3P3N Factor inhibiting HIF-1 Alpha in complex with Notch 1 fragment mouse notch (1930-1949) peptide Deposited 2010-10-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–349（349 aa）	Not recorded	FE2 FE (II) ION × 2 SO4 SULFATE ION × 4 AKG 2-OXOGLUTARIC ACID × 2 GOL GLYCEROL × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；1.6M AMMONIUM SULFATE, 4% PEG400, 0.1M HEPES PH7.5, NITROGEN ATMOSPHERE, 20MG/ML PROTEIN WITH 1MM FE(II), 2.0MM 2OG AND 10MM PEPTIDE , VAPOR DIFFUSION, SITTING DROP, temperature 298.0K	Resolution 2.40 Å R-free 0.244
3P3P Factor inhibiting HIF-1 Alpha in complex with Notch 1 fragment mouse notch (1997-2016) peptide Deposited 2010-10-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–349（349 aa）	Not recorded	FE2 FE (II) ION × 2 AKG 2-OXOGLUTARIC ACID × 2 SO4 SULFATE ION × 4 GOL GLYCEROL × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；1.6M AMMONIUM SULFATE, 4% PEG400, 0.1M HEPES PH7.5, NITROGEN ATMOSPHERE, 20MG/ML PROTEIN WITH 1MM FE(II), 2.0MM 2OG AND 10MM PEPTIDE , VAPOR DIFFUSION, SITTING DROP, temperature 298.0K	Resolution 2.60 Å R-free 0.259
4AI8 FACTOR INHIBITING HIF-1 ALPHA IN COMPLEX WITH DAMINOZIDE Deposited 2012-02-08	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	SO4 SULFATE ION × 10 GOL GLYCEROL × 6 DZA DAMINOZIDE × 2 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.1 M HEPES PH7.5, 1.6 M AMMONIUM SULFATE, 6% PEG400, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 293K	Resolution 2.40 Å R-free 0.248
4B7E FACTOR INHIBITING HIF-1 ALPHA IN COMPLEX WITH CONSENSUS ANKYRIN REPEAT DOMAIN-LEU PEPTIDE (20-MER) Deposited 2012-08-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–349（349 aa）	Not recorded	ZN ZINC ION × 2 OGA N-OXALYLGLYCINE × 2 SO4 SULFATE ION × 10 GOL GLYCEROL × 8	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；1.6M AMMONIUM SULPHATE, 6% PEG400, 0.1M HEPES PH 7.5	Resolution 2.50 Å R-free 0.255
4B7K FACTOR INHIBITING HIF-1 ALPHA IN COMPLEX WITH CONSENSUS ANKYRIN REPEAT DOMAIN-SER PEPTIDE (20-MER) Deposited 2012-08-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–349（349 aa）	Not recorded	ZN ZINC ION × 2 OGA N-OXALYLGLYCINE × 2 SO4 SULFATE ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；1.6 M AMMONIUM SULPHATE, 6% PEG 400, 0.1 M HEPES PH 7.5	Resolution 2.39 Å R-free 0.241
4BIO FACTOR INHIBITING HIF-1 ALPHA IN COMPLEX WITH 8-HYDROXYQUINOLINE-5- CARBOXYLIC ACID Deposited 2013-04-12	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	FE FE (III) ION × 2 8XQ 8-hydroxyquinoline-5-carboxylic acid × 2 SO4 SULFATE ION × 10 GOL GLYCEROL × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；1.2M AMMONIUM SULPHATE, 3% PEG400, PEG400, 0.001M FECL2, 0.1M HEPES PH7.5, VAPOR DIFFUSION, SITTING DROP	Resolution 2.45 Å R-free 0.234
4JAA Factor inhibiting HIF-1 alpha in complex with consensus ankyrin repeat domain-(d)LEU peptide Deposited 2013-02-18	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	ZN ZINC ION × 1 OGA N-OXALYLGLYCINE × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；1.6M AMMONIUM SULPHATE, 6% PEG 400, 0.1M HEPES PH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.39 Å R-free 0.219
4NR1 Factor inhibiting HIF-1 alpha in complex with consensus ankyrin repeat domain-(d)allyl-GLY peptide Deposited 2013-11-26	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	ZN ZINC ION × 1 OGA N-OXALYLGLYCINE × 1 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；1.6M AMMONIUM SULPHATE, 6% PEG 400, 0.1M HEPES, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.68 Å R-free 0.210
4Z1V Structure of Factor Inhibiting HIF (FIH) in complex with Fe, NO, and NOG Deposited 2015-03-27	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	OGA N-OXALYLGLYCINE × 2 NO NITRIC OXIDE × 2 PEG DI(HYDROXYETHYL)ETHER × 2 FE FE (III) ION × 2 SO4 SULFATE ION × 10	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；0.1M Hepes, 1.6mM ammonium sulfate, 3% PEG 400	Resolution 2.10 Å R-free 0.240
4Z2W Factor Inhibiting HIF in Complex with Fe, and Alpha-Ketoglutarate Deposited 2015-03-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	AKG 2-OXOGLUTARIC ACID × 2 PEG DI(HYDROXYETHYL)ETHER × 2 FE FE (III) ION × 2 SO4 SULFATE ION × 10	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；0.1M Hepes, 1.6mM ammonium sulfate, 3% PEG 400	Resolution 2.50 Å R-free 0.246
5JWK Factor Inhibiting HIF D201E in Complex with Fe, and Alpha-Ketoglutarate Deposited 2016-05-12	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Mutation：D201E	AKG 2-OXOGLUTARIC ACID × 2 PEG DI(HYDROXYETHYL)ETHER × 2 FE2 FE (II) ION × 2 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0.1M Hepes, 1.6mM ammonium sulfate, 3% PEG 400	Resolution 2.30 Å R-free 0.227
5JWL Factor Inhibiting HIF D201E in Complex with Zn, and Alpha-Ketoglutarate Deposited 2016-05-12	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Mutation：D201E	AKG 2-OXOGLUTARIC ACID × 2 PEG DI(HYDROXYETHYL)ETHER × 2 ZN ZINC ION × 2 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0.1M Hepes, 1.6mM ammonium sulfate, 3% PEG 400	Resolution 2.40 Å R-free 0.226
5JWP Crystal structure of human FIH D201E variant in complex with Zn, alpha-ketoglutarate, and HIF1 alpha peptide. Deposited 2016-05-12	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–349（349 aa）	Mutation：D201E	AKG 2-OXOGLUTARIC ACID × 2 GOL GLYCEROL × 2 ZN ZINC ION × 2 SO4 SULFATE ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0.1M Hepes, 1.6mM ammonium sulfate, 3% PEG 400	Resolution 2.10 Å R-free 0.209
5OP6 Factor Inhibiting HIF (FIH) in complex with zinc and GSK128863 Deposited 2017-08-09	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–349（349 aa）	Not recorded	ZN ZINC ION × 1 SO4 SULFATE ION × 2 A0W 2-[[1,3-dicyclohexyl-4-oxidanyl-2,6-bis(oxidanylidene)pyrimidin-5-yl]carbonylamino]ethanoic acid × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；300 K；0.1M HEPES pH7.5, 1.1M ammonium sulfate, 2.5% PEG 400	Resolution 2.45 Å R-free 0.227
5OP8 Factor Inhibiting HIF (FIH) in complex with zinc and Molidustat Deposited 2017-08-09	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	ZN ZINC ION × 2 A1H 2-(6-morpholin-4-ylpyrimidin-4-yl)-4-(1,2,3-triazol-1-yl)-1~{H}-pyrazol-3-one × 2 SO4 SULFATE ION × 6 GOL GLYCEROL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；300 K；0.1M HEPES pH7.5, 1.4M ammonium sulfate, 4.5% PEG400	Resolution 2.30 Å R-free 0.214
5OPC Factor Inhibiting HIF (FIH) in complex with zinc and Vadadustat Deposited 2017-08-09	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	SO4 SULFATE ION × 10 ZN ZINC ION × 2 GOL GLYCEROL × 10 A1Z Vadadustat × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；300 K；0.1M HEPES pH7.5, 1.7M ammonium sulfate, 5.5% PEG 400	Resolution 2.30 Å R-free 0.214
6H9J Factor Inhibiting HIF (FIH) in complex with zinc, NOG and TRPV3 (229-255) Deposited 2018-08-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 12–349（338 aa）	Not recorded	OGA N-OXALYLGLYCINE × 2 GOL GLYCEROL × 6 SO4 SULFATE ION × 8 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.1 M Hepes pH = 7.5, 1.8 M ammonium sulfate, 4.5% PEG400	Resolution 1.83 Å R-free 0.187
6HA6 Factor Inhibiting HIF (FIH) in complex with zinc, NOG and TRPV3 (220-246) Deposited 2018-08-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–349（349 aa）	Not recorded	OGA N-OXALYLGLYCINE × 2 SO4 SULFATE ION × 8 GOL GLYCEROL × 6 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.1 M Hepes pH = 7.5, 1.7 M ammonium sulfate, 5.5% PEG400	Resolution 1.98 Å R-free 0.203
6HC8 Factor Inhibiting HIF (FIH) in complex with zinc, NOG and TRPA1 (313-339) Deposited 2018-08-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–349（349 aa）	Not recorded	ZN ZINC ION × 2 OGA N-OXALYLGLYCINE × 2 SO4 SULFATE ION × 2 GOL GLYCEROL × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.1 M Hepes pH = 7.5, 1.6 M ammonium sulfate, 6% PEG400	Resolution 1.90 Å R-free 0.189
6HKP Factor Inhibiting HIF (FIH) in complex with zinc, NOG and ASPP2 (970-992) Deposited 2018-09-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–349（349 aa）	Not recorded	SO4 SULFATE ION × 12 GOL GLYCEROL × 10 OGA N-OXALYLGLYCINE × 2 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.1 M Hepes pH = 7.5, 2.0 M ammonium sulfate, 5.5% PEG400	Resolution 1.90 Å R-free 0.195
6HL5 Factor Inhibiting HIF (FIH) in complex with zinc, NOG and ASPP1(932-954) Deposited 2018-09-10	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–349（349 aa）	Not recorded	GOL GLYCEROL × 8 SO4 SULFATE ION × 8 ZN ZINC ION × 2 OGA N-OXALYLGLYCINE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.1 M Hepes pH = 7.5, 1.2 M ammonium sulfate, 4.5% PEG400	Resolution 1.98 Å R-free 0.201
6HL6 Factor Inhibiting HIF (FIH) in complex with zinc, NOG and iASPP(670-693) Deposited 2018-09-10	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–349（349 aa）	Not recorded	GOL GLYCEROL × 10 SO4 SULFATE ION × 6 ZN ZINC ION × 2 OGA N-OXALYLGLYCINE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；273 K；0.1 M Hepes pH = 7.5, 1.6 M ammonium sulfate, 3.5% PEG400	Resolution 1.97 Å R-free 0.205
6RUJ Factor inhibiting HIF-1 alpha in complex with consensus ankyrin repeat domain-(d)3-hydroxy-Leu peptide Deposited 2019-05-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–349（349 aa）	Not recorded	ZN ZINC ION × 2 OGA N-OXALYLGLYCINE × 2 SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；1.6M AMMONIUM SULPHATE, 6% PEG 400, 0.1M HEPES, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.42 Å R-free 0.257
7A1J FACTOR INHIBITING HIF-1 ALPHA IN COMPLEX WITH ZN(II) AND 3-(3-phenylpropyl)-2-oxoglutarate Deposited 2020-08-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	ZN ZINC ION × 2 SO4 SULFATE ION × 10 QVN 3-(3-phenylpropyl)-2-oxoglutarate × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；1.6M AMMONIUM SULPHATE, 6% PEG 400, 0.1M HEPES PH 7.5	Resolution 1.90 Å R-free 0.209
7A1K FACTOR INHIBITING HIF-1 ALPHA IN COMPLEX WITH ZN(II) AND 3-((9,9-dimethyl-9H-fluoren-2-yl)methyl)-2-oxoglutarate Deposited 2020-08-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	ZN ZINC ION × 2 QVZ 3-((9,9-dimethyl-9H-fluoren-2-yl)methyl)-2-oxoglutarate × 2 SO4 SULFATE ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；1.6M AMMONIUM SULPHATE, 6% PEG 400, 0.1M HEPES PH 7.5	Resolution 1.99 Å R-free 0.227
7A1L FACTOR INHIBITING HIF-1 ALPHA IN COMPLEX WITH ZN(II) AND 3-methyl-2-oxoglutarate Deposited 2020-08-13	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–349（349 aa）	Not recorded	ROQ (3~{S})-3-methyl-2-oxidanylidene-pentanedioic acid × 1 ZN ZINC ION × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；1.6M AMMONIUM SULPHATE, 6% PEG 400, 0.1M HEPES PH 7.5	Resolution 2.29 Å R-free 0.222
7A1M FACTOR INHIBITING HIF-1 ALPHA IN COMPLEX WITH ZN(II) AND 3-propyl-2-oxoglutarate Deposited 2020-08-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	ZN ZINC ION × 2 QVW 3-propyl-2-oxoglutarate × 2 SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；1.6M AMMONIUM SULPHATE, 6% PEG 400, 0.1M HEPES PH 7.5	Resolution 2.18 Å R-free 0.245
7A1N FACTOR INHIBITING HIF-1 ALPHA IN COMPLEX WITH ZN(II), 3-methyl-2-oxoglutarate, AND CONSENSUS ANKYRIN REPEAT DOMAIN (20-MER) Deposited 2020-08-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	SO4 SULFATE ION × 9 ZN ZINC ION × 1 ROQ (3~{S})-3-methyl-2-oxidanylidene-pentanedioic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；1.6M AMMONIUM SULPHATE, 6% PEG 400, 0.1M HEPES PH 7.5	Resolution 2.01 Å R-free 0.234
7A1O FACTOR INHIBITING HIF-1 ALPHA IN COMPLEX WITH ZN(II), 4-ethyl-2-oxoglutarate, AND CONSENSUS ANKYRIN REPEAT DOMAIN (20-MER) Deposited 2020-08-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–349（349 aa）	Not recorded	ZN ZINC ION × 2 SO4 SULFATE ION × 8 QVT 4-ethyl-2-oxoglutarate × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；1.6M AMMONIUM SULPHATE, 6% PEG 400, 0.1M HEPES PH 7.5	Resolution 2.21 Å R-free 0.243
7A1P FACTOR INHIBITING HIF-1 ALPHA IN COMPLEX WITH ZN(II), 4-propyl-2-oxoglutarate, AND CONSENSUS ANKYRIN REPEAT DOMAIN (20-MER) Deposited 2020-08-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–349（349 aa）	Not recorded	ZN ZINC ION × 2 SO4 SULFATE ION × 6 QW2 (4~{S})-2-oxidanylidene-4-propyl-pentanedioic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；1.6M AMMONIUM SULPHATE, 6% PEG 400, 0.1M HEPES PH 7.5	Resolution 1.76 Å R-free 0.191
7A1Q FACTOR INHIBITING HIF-1 ALPHA IN COMPLEX WITH ZN(II), 3-(carboxycarbonyl)cyclopentane-1-carboxylic acid, AND CONSENSUS ANKYRIN REPEAT DOMAIN (20-MER) Deposited 2020-08-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–349（349 aa）	Not recorded	ZN ZINC ION × 2 SO4 SULFATE ION × 6 QVQ 3-(carboxycarbonyl)cyclopentane-1-carboxylic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；1.6M AMMONIUM SULPHATE, 6% PEG 400, 0.1M HEPES PH 7.5	Resolution 1.75 Å R-free 0.200
7A1S FACTOR INHIBITING HIF-1 ALPHA IN COMPLEX WITH ZN(II), 3-methyl-2-oxoglutarate, AND TANKYRASE-2 (TNKS2) FRAGMENT PEPTIDE (21-MER) Deposited 2020-08-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	SO4 SULFATE ION × 8 ROQ (3~{S})-3-methyl-2-oxidanylidene-pentanedioic acid × 1 ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；1.6M AMMONIUM SULPHATE, 6% PEG 400, 0.1M HEPES PH 7.5	Resolution 2.01 Å R-free 0.209
8II0 FACTOR INHIBITING HIF-1 ALPHA in complex with (5-(3-(3-chlorophenyl)isoxazol-5-yl)-3-hydroxypicolinoyl)glycine Deposited 2023-02-24	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–349（349 aa）	Not recorded	P5I 2-[[5-[3-(3-chlorophenyl)-1,2-oxazol-5-yl]-3-oxidanyl-pyridin-2-yl]carbonylamino]ethanoic acid × 1 GOL GLYCEROL × 2 ZN ZINC ION × 1 SO4 SULFATE ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；1.6 M AMMONIUM SULPHATE, 6% PEG 400, 0.1 M HEPES.	Resolution 2.04 Å R-free 0.239
8K71 Factor-inhibiting hypoxia-inducible factor in complex with Zn(II) and 2-(3-hydroxy-2-((2-((naphthalen-2-ylmethyl)sulfonyl)acetyl)imino)-2,3-dihydrothiazol-4-yl)acetic acid Deposited 2023-07-26	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	ZN ZINC ION × 2 VIZ 2-[(2~{Z})-2-[2-(naphthalen-2-ylmethylsulfonyl)ethanoylimino]-3-oxidanyl-1,3-thiazol-4-yl]ethanoic acid × 2 SO4 SULFATE ION × 16 GOL GLYCEROL × 14	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；0.27 mM FIH, 0.5 mM zinc acetate, 2 mM BNS, 0.1 M HEPES, pH 7.5, 6%w/v PEG400, 1.6 M ammonium sulfate	Resolution 2.23 Å R-free 0.236
8K72 Factor-inhibiting hypoxia-inducible factor in complex with Zn(II) and 2-(3-hydroxy-2-((3-(phenylsulfonamido)propanoyl)imino)-2,3-dihydrothiazol-4-yl)acetic acid Deposited 2023-07-26	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	SO4 SULFATE ION × 20 GOL GLYCEROL × 6 ZN ZINC ION × 2 VJF 2-[(2~{Z})-3-oxidanyl-2-[3-(phenylsulfonylamino)propanoylimino]-1,3-thiazol-4-yl]ethanoic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；0.27 mM FIH, 0.5 mM zinc acetate, 2 mM TC167, 0.1 M HEPES, pH 7.5, 6%w/v PEG400, 1.6 M ammonium sulfate	Resolution 2.45 Å R-free 0.239
8K73 Factor-inhibiting hypoxia-inducible factor in complex with Zn(II) and 2-(3-hydroxy-2-((1-(phenylsulfonyl)pyrrolidine-3-carbonyl)imino)-2,3-dihydrothiazol-4-yl)acetic acid Deposited 2023-07-26	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	SO4 SULFATE ION × 14 GOL GLYCEROL × 14 ZN ZINC ION × 2 VK6 2-[(2~{Z})-3-oxidanyl-2-[(3~{R})-1-(phenylsulfonyl)pyrrolidin-3-yl]carbonylimino-1,3-thiazol-4-yl]ethanoic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；0.27 mM FIH, 0.5 mM zinc acetate, 2 mM RT105, 0.1 M HEPES, pH 7.5, 6%w/v PEG400, 1.6 M ammonium sulfate	Resolution 2.02 Å R-free 0.223
9FSN FIH in complex with Enarodustat crystal structure at 2.2A Deposited 2024-06-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	MN MANGANESE (II) ION × 2 A1IF7 Enarodustat × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；290 K；Morpheus 1, well C1, 0.09 M NPS, 0.1 M Buffer System 1 pH 6.5, 30 % Precipitant Mix 1	Resolution 2.20 Å R-free 0.208
9I4H Factor Inhibiting HIF (FIH) in complex with manganese and 3-Hydroxy-5-(3-(4-(hydroxymethyl)-3-nitrophenyl)isoxazol-5-yl)picolinoyl)glycine Deposited 2025-01-24	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	MN MANGANESE (II) ION × 2 A1IZ5 N-[(5P)-3-hydroxy-5-{(3P)-3-[4-(hydroxymethyl)-3-nitrophenyl]-1,2-oxazol-5-yl}pyridine-2-carbonyl]glycine × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；290 K；Morpheus C5 0.09 M NPS 0.1 M Buffer System 2 7.5 30 % v/v Precipitant Mix 2	Resolution 2.30 Å R-free 0.218
9IIF Factor inhibiting HIF-1 alpha in complex with Zn(II) and Desidustat Deposited 2024-06-20	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–349（349 aa）	Not recorded	SO4 SULFATE ION × 8 A1L2L 2-[[1-(cyclopropylmethoxy)-2-oxidanyl-4-oxidanylidene-quinolin-3-yl]carbonylamino]ethanoic acid × 1 ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；0.27 mM FIH, 0.5 mM zinc acetate, 2 mM densidustat, 0.1 M HEPES, pH 7.5, 6% w/v PEG400, 1.6 M ammonium sulfate	Resolution 2.16 Å R-free 0.244
9JTX Factor inhibiting HIF-1 alpha in complex with Zn(II) and 2-(4-hydroxy-2-oxo-1-(thiazol-4-ylmethoxy)-1,2-dihydroquinoline-3-carboxamido)-2-methylpropanoic acid Deposited 2024-10-07	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–349（349 aa）	Not recorded	SO4 SULFATE ION × 7 A1L4V 2-methyl-2-[[4-oxidanyl-2-oxidanylidene-1-(1,3-thiazol-4-ylmethoxy)quinolin-3-yl]carbonylamino]propanoic acid × 1 ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.1 M HEPES, pH 7.5, 6%w/v PEG400, 1.6 M ammonium sulfate	Resolution 2.08 Å R-free 0.247
9M23 FIH [Factor Inhibiting HIF (Hypoxia Inducible Factor)] in complex with Zn(II) and N-((4-(trifluoromethyl)phenyl)sulfonyl)picolinamide (SB133) Deposited 2025-02-27	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–349（349 aa）	Not recorded	GOL GLYCEROL × 1 ZN ZINC ION × 1 A1L8D ~{N}-[4-(trifluoromethyl)phenyl]sulfonylpyridine-2-carboxamide × 1 SO4 SULFATE ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；1.6M AMMONIUM SULPHATE, 6% PEG 400, 0.1M HEPES PH 7.5	Resolution 2.16 Å R-free 0.226

60 other PDB entries and 64 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	HIF1N_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–349； UniProt 1–349

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8ihz
Deposition date deposition_date	2023-02-24
Structure title title	FACTOR INHIBITING HIF-1 ALPHA in complex with (5-(1-(3-(4-chlorophenyl)propyl)-1H-1,2,3-triazol-4-yl)-3-hydroxypicolinoyl)glycine
Keywords keywords	factor-inhibiting hypoxia-inducible factor, FIH, 2OG dependent dioxygenase, OXIDOREDUCTASE; OXIDOREDUCTASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	21.57 Å
Radius of gyration Rg (electron density) rg_electron	20.43 Å
Forward intensity I(0) i0	30382600.00
Molecular weight molecular_weight	40235.0 kDa
Excluded volume excluded_volume	49312 Å³
Envelope volume envelope_volume	60267 Å³
Hydration-shell volume shell_volume	24041 Å³
Envelope diameter envelope_diameter	71.8 Å
Shell Rg shell_rg	27.78 Å
Envelope Rg envelope_rg	20.92 Å
Shape Rg shape_rg	20.39 Å
Total Rg total_rg	21.44 Å
Total atoms total_atoms	5383
Residues n_residues	341
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	70.6 Å
Rg (real space) rg_real	21.44 Å
Rg uncertainty (real space) rg_real_error	0.39 Å
I(0) (real space) i0_real	3.0380e+07
I(0) uncertainty (real space) i0_real_error	4.1030e+05
Rg (reciprocal space) rg_reciprocal	21.47 Å
I(0) (reciprocal space) i0_reciprocal	30380000.0000
Solution quality estimate total_estimate	0.6641
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	27.0 Å
Skewness Skewness skewness	0.224
Kurtosis Kurtosis kurtosis	-0.255
Angular range angular_range	— – 0.3700 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	6491000.0000
Real-space data points n_real_points	69
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.811; Stabil: 1.000; Sysdev: 0.083; Positv: 1.000; Valcen: 0.998; Smooth: 0.949

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Hypoxia-inducible factor 1-alpha inhibitor
Molecular weight formula_weight	40328.3 kDa
EC 编号 ec_number	1.14.11.30,1.14.11.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	5489

MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	14

Entity 3 Entity 3 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	2-[[5-[1-[3-(4-chlorophenyl)propyl]-1,2,3-triazol-4-yl]-3-oxidanyl-pyridin-2-yl]carbonylamino]ethanoic acid
Molecular weight formula_weight	415.8 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	77

▶

8. Citations (1)

▶

Unit-cell length a length_a	86.578 Å
Unit-cell length b length_b	86.578 Å
Unit-cell length c length_c	147.416 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 41 21 2
Space-group number int_tables_number	92
Crystal system crystal_system	tetragonal

Resolution resolution	2.220 Å
Low-resolution limit resolution_low	61.220 Å
R factor r_factor	0.2291
R_work r_work	0.2267
R_free r_free	0.2613

fit	/app/data/saxs_computation/ih/8ihz/8ihz.fit
pddf	/app/data/pr_computation/ih/8ihz/8ihz.pr.out
profile	/app/data/saxs_computation/ih/8ihz/8ihz.dat